SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002807 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002807
Domain Number 1 Region: 1505-1695,1728-1753
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.73e-37
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 2 Region: 736-883,917-964
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.28e-31
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 3 Region: 135-278,349-418
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.32e-27
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 4 Region: 1257-1335,1375-1454
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.8e-18
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000002807
Domain Number - Region: 1760-1806
Classification Level Classification E-value
Superfamily EF-hand 0.00055
Family Calmodulin-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002807   Gene: ENSGMOG00000002635   Transcript: ENSGMOT00000002898
Sequence length 1969
Comment pep:novel genescaffold:gadMor1:GeneScaffold_155:34422:74938:-1 gene:ENSGMOG00000002635 transcript:ENSGMOT00000002898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPIMAPPGPDSFKKFTPESLANIEKRILEEKNKKPPKPRSDSSHRDADDENERKPNSD
LEAGKSVPFIYGDVPKGMFAIPLQDLDPYYINEKTFIVINKGKTIFRFSATDSLYIIQPF
NLFRRIAIKILIHSYPFMIIMCTILTNCIFMTFSDPPEWSKQVEYTFTGIYTFESLTKIV
ARGFAIDSFTFLRDPWNWLDFMVISMAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLK
TIVGALIQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRHKCVFWPINMSEAFPNGTNF
DWDDYIMNRTNFYFLPNQLDALICGNSSDAGRCPEGYTCMKAGRNPNYGYTSFDSFGWAF
LTLFRLMTQDFWENLYMLTLRAAGKTYMIFFVLVIFVGSFYLVNLILAVVAMAYEEQNQA
TIEEAEQKEAEFKAMLEQLKKQQEETQAAAMATSAGTVSEPALDEEGGGQLSRSSSEVSK
LSSKSAKERRNRKKKWRQKEQEKEKGDSEKVVKSESDDGSKRSGLRFPGSRLGRKASIMN
QSLLSIPGSPFMSRHNSRSSIFSFKGRSKDAGSENEFADDEHSTVEESEDRRGSLFIPYR
RNSYSGYSQGSSRIHPLAPHTGGKRNSTVDCNGVVSLIGPGPGGRLLPETTEVEVKKKHS
GSLMVSVDQLNCSFKGKDRANSQMSVVTNTLMEELEESQRSCPPCWYKFANMFLIWECFP
FWLKIKHVTYLIVMDPFVDLAITICIVLNTLFMAMEHYPMTPHFEEVLSVGNLVFTGIFA
AEMFAKLVAMDPYYYFQEGWNIFDGFIVTLSLVELGLADVEGLSVLRSFRLLRVFKLAKS
WPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKDCVCKIAEDCVLPRW
HMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMCLTVFMMVMVIGNLVVLNLFLALLL
SSFSADNLAATDDDGEPNNLQLAMARMKIGIAWFKVHMRILMAHILKKPLEDEQKPLDDM
YDKKLNCIANHTGVEINRELDYAKNGNGTTSGIGSSVGKYMIDEDYMSFIHNPNLTVCVP
IAVGESDFENLNTEDFSSESDVENSKDLDDTSSSEGSTIDIKPDLEEVALVEVVEEYLDP
DACWTDECIAKYKCCDVPITHGWGKHWWFLRKTCYLIVEHNWFETLIIFMILLSSGALXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSIV
SLIANALGYSDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIF
WLIFSIMGVNLFAGKYYFCYNETAEAIFLPHEVNNKTECLAFINANYTNVRWKNVKINFD
NVGAGYLALLQVATFKGWMDIMYAAIDSRKVEDQPIYEDNLYMYVYFVVFIIFGSFFTLN
LFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPLNAFQGMVFD
FVTQQVFDISIMILICLNMVTMMVETDDQTDETEHILYWVNFVFIVAFTTEFVLKLFALR
HYYFTIGWNVFDVVVVILSVVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGI
RTLLFALMMSLPALFNIGLLLFLVMFIFSIFGMSNFGYVKHGAGIDDMYNFETFGNSMIC
LFMITTSAGWDGLLLPILNYPPDCDPTLENAGTPATGDCGNPSVGIFFFVMYIIISFLIV
VNMYIAIILENFSVATEESADPLSEDDFETFYEIWEKFDPDASQFITYSKLSDFADSLDQ
PLRVSKPNTIELIAMDMPMVSGDRIHCLDILFAFTKRVLGDSGELDMLRQQMEERFVAAN
PSKVSYEPITTTLRRKQEDVSAKIIQRAYRSYLARRGFVCKRKQANNKVENGGTNQDHEK
KEGTPSTGSLPSYDSVTKPDKEKQDDNQEGRGGRKEKGRNQKDVRESKC
Download sequence
Identical sequences ENSGMOP00000002807 ENSGMOP00000002807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]