SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002944 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002944
Domain Number 1 Region: 124-338
Classification Level Classification E-value
Superfamily vWA-like 1.42e-69
Family Integrin A (or I) domain 0.000000127
Further Details:      
 
Domain Number 2 Region: 338-382
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000000000309
Family Integrin domains 0.00092
Further Details:      
 
Domain Number 3 Region: 22-73
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000335
Family Plexin repeat 0.00061
Further Details:      
 
Domain Number 4 Region: 76-146
Classification Level Classification E-value
Superfamily Integrin domains 0.00000126
Family Integrin domains 0.001
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000002944
Domain Number - Region: 389-417
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0012
Family Integrin beta EGF-like domains 0.034
Further Details:      
 
Domain Number - Region: 434-465
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0156
Family Integrin beta EGF-like domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002944   Gene: ENSGMOG00000002791   Transcript: ENSGMOT00000003037
Sequence length 480
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2262:22481:37070:-1 gene:ENSGMOG00000002791 transcript:ENSGMOT00000003037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMNPATLLRRATLCCMVFESLNVCMSGSATSCEECILIHPSCAWCAQEAGRVRCDLTQSL
QIRGCKAQFIEFPSSQTSILKSNPLSTKGSAPSQNEVTQIMPQKISVSLRPGDQTSFQVQ
VRQVEDYPVDLYYLMDLSLSMKDDLVTIHNLGTKLTEEMSRLTSNFRLGFGTFVDKNISP
FSYTEPKYQNNPCNGYTLFPNCVPSFGFRHVLSLTDKVDRFNQEVQKQMVSRNRDAPEGG
FDAIVQAAVCKEEIGWRKEAFHLLVFATDDVPHLALDGKLGGLVNPNDGECHLDKNNENS
ASTQMDYPSLGLLGEKLAENNIYLIFAVTRRYYVIYKVSFDVNVEARSCPKGAASQSFTI
KPVGFKDRLEVTVDYSCDCGCTRAAQTNSSVCSSTGTFTCGKCYCEPGYLGSHCECQEGE
SGNNPLGACREAEGKRMCSGRGECSCNQCLCYESEFGKVYGSFCECDDFSCARHKGVLCA
Download sequence
Identical sequences ENSGMOP00000002944 ENSGMOP00000002944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]