SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002960 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002960
Domain Number 1 Region: 2126-2405
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-99
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000042
Further Details:      
 
Domain Number 2 Region: 664-772
Classification Level Classification E-value
Superfamily Second domain of FERM 3.53e-28
Family Second domain of FERM 0.00035
Further Details:      
 
Domain Number 3 Region: 1296-1401
Classification Level Classification E-value
Superfamily PDZ domain-like 7.76e-28
Family PDZ domain 0.00021
Further Details:      
 
Domain Number 4 Region: 774-901
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-27
Family Third domain of FERM 0.0024
Further Details:      
 
Domain Number 5 Region: 1926-2025
Classification Level Classification E-value
Superfamily PDZ domain-like 3.42e-23
Family PDZ domain 0.012
Further Details:      
 
Domain Number 6 Region: 1086-1183
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-22
Family PDZ domain 0.0073
Further Details:      
 
Domain Number 7 Region: 1416-1533
Classification Level Classification E-value
Superfamily PDZ domain-like 1.22e-20
Family PDZ domain 0.021
Further Details:      
 
Domain Number 8 Region: 1702-1788
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-17
Family PDZ domain 0.0098
Further Details:      
 
Domain Number 9 Region: 570-664
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.93e-16
Family First domain of FERM 0.01
Further Details:      
 
Domain Number 10 Region: 1800-1887
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000578
Family PDZ domain 0.053
Further Details:      
 
Domain Number 11 Region: 44-159
Classification Level Classification E-value
Superfamily PAZ domain 0.000000353
Family PAZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002960   Gene: ENSGMOG00000002695   Transcript: ENSGMOT00000003054
Sequence length 2413
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4501:91741:157431:-1 gene:ENSGMOG00000002695 transcript:ENSGMOT00000003054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVSLAEALEVRGGPLQEDEVWAVLSQSAESLHELFHKADPSAMGFIISPWSLLLMPSGN
ISFTDENVTQQDLRAFTAPEVLEGIPLASVSDIEKMHMYSLGMTLFWGADYQIPHSQPMK
LGEHLNSLLLNMCDDITLSRMSVRTVLDICSKHIRNSSCEPPFAYVRKLVRLVLGSLSQV
RLDGLLTDRESLPERSKEIRERLRGKGLPSGRGAASRVLERYRVRTQEQASLNRGMSRSM
SSLPLLDPQSQDETYPLQYSPSDYPPHSESTSHAFQPQLRSRPVELDQRSLQYSGCRKTW
ASSVDLACIDPDALRFGALEDARRGSSALSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLHTHQRYHSDYSSSSESPSVTS
SDPEYRQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLYDGPASDEGLAGAELLLR
SQEEEVQRLQAHLAVRLSRANLYMPDEMSPASRASVADLQGDPFSTPTHGQRKAKSFYGP
EFVKMTSEPCVSLTVPSSIMKRGKGEEVQRKVGVALLNGQRLELGCDLKAVCKDVLDMVV
AHVGLVEHHLFGLAYLKAQDNEFFFVDPDAKLTKVAPEGWKEEPKKKKSDVPFNLFLRIK
FFVDDVSFIQHVMTKHQYYLQLRKDILEERLRCDTENAMLLASLALQAEFSDYQPELHGK
TYFRLEHYLSVSVLDKMEQAAVKEKLPRLHSSYYGVPEGQAELEFLKVSQRLTEYGVHFH
RVLPEKRSQTGIMLGVYSKGALIFEVLNANRTPVLRFPWRDTKKISFTKKKICLQNMSDG
IKHLFQTDSNKTCQYLLQLCSDQHKFHLQMKARQNNQEQQELENSPLASMQYSLDPQGEP
LSRAGGPGSLTPSSTRSDPELFKRISYSEAALHKALSGQLTPQDEAPLFPGFVPASSSSS
SNPRLMSRSHHNLGQVPESPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLK
KKLNALPSPEREIKTVNLKKDVKXXXXGFQITGGEDSGRMDLGTIVSAITPGGPADLNSC
LKPGDRLLSVNNVSLEGLPHAAAVEVLQSAPDDITLVVSQPKESLYQQRQALDLDSSSEE
LVDAESPRTPLPPSSVLRLPSSLSSQDSRASSSPGLGPGAPALPPKTRKAKVPEAPKVTE
TSDWGDSDMDEDTCSSGPEKQGLGKDAYGSAEHLSGKGPGVSSLLPGDLFDVELSKQDSG
LGISVTGGVNTTVRHGGIYIKAIIPNGAAEMDGRIQKGDRVVAVNGRSLEGATHAEAVEA
LRDTKKSVHLLLEKGQPPTDSVHAPLTPRCTPPKVRDRAPPPPPKTPPPYGFVTDDNVFD
VCLLKNTSGLGFSFSREDRVPGETPGASSMVRVKKLFPGQPAAESGRVNVGDVILRVNKT
SLKGLSQHEVISALRGAGQEVVLHLCRPEPGLLPDMDASILTPKSPRKELSVPRPQPSPR
LARRPPPARGSPRGGGPVQEALERLLQHKNPGRRNSYSDSTEEGGDEEEEAFSPERSRLE
GWDNSIYKTPSGSLGRGRFEGPGPLDDSTHSAFYSPNLELESPTQPMMSSPTSPSPDPLP
PPLPLPLNLTIPGNGQDMDDLVPEVELKVSLVKSEKGSLGFTLTKGNDQGCYIHDIIQDP
ARGDGRLRSGDRMITVNNTDVSSMGHTEVVNLVRAAPAVVDLTVGRVLEAPKGPVEAHLL
PDICFSGDTETLGLVLDGGCDSPYGVLFVKELLPGSLAASEGSLRPLDLVHYINGAPVQE
LTLSESRRLMELKPSELTLKATRDGKAVTPGLQKSVSFLNNNVSANVSNSMNGSDHSEED
CLSTLCPIEQEEITRLQLDKPPEGGLGFSVIGGERGIFVKSVTPGGLADASTKLRVGDRL
LRVNEELMTGVSHTKAVTTIRRAKGLVQLVVSRPPDHHLSYLPITSDKCNGNAGSTDYPA
RRRGGAASSTELSEDTDCDGSSLPEDSPEAGLPESGLSYLQMSAGQPEEDAITWPPPTVS
PSDGPIISEDQLTSLPLVKVVPDGQYTGTHLNAVVRMMRGLLEQKVPLQEFENLQNLQPL
DDCLIGQTKENKKKNRYKNIVPFDSTRVTLGQDGGYINANFITMAVKDESYPFIACQGPL
PTTLGDFWQMVWEQKANVIAMMTQEVEGGKVKCQRYWPDTPGTAEMVDERLQVALVKDQH
LENFVIRFIEVKDMQTNEIQRVTHLNYTGWPDHGTPSQPSHLLTFISYMRHIHQSGPVIT
HCSAGIGRSGTLICIDVVLGLISKDTDFDISDVVRNMRLQRQGMVQTEEQYIFCYQVILY
VLRCLQAEEKLSG
Download sequence
Identical sequences ENSGMOP00000002960 ENSGMOP00000002960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]