SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002985 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002985
Domain Number 1 Region: 125-368
Classification Level Classification E-value
Superfamily vWA-like 1.93e-84
Family Integrin A (or I) domain 0.000000223
Further Details:      
 
Domain Number 2 Region: 347-456
Classification Level Classification E-value
Superfamily Integrin domains 3.71e-21
Family Integrin domains 0.00081
Further Details:      
 
Domain Number 3 Region: 13-71
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000251
Family Plexin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002985   Gene: ENSGMOG00000002809   Transcript: ENSGMOT00000003080
Sequence length 788
Comment pep:novel genescaffold:gadMor1:GeneScaffold_409:362666:379957:-1 gene:ENSGMOG00000002809 transcript:ENSGMOT00000003080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FCCSISRAQKEGNECINANAKYCGECIQAGAKCGWCRHPDFLKQGEAVSSRCDELQSLLI
RGCSLADIENPRGGQRVLLDRPVTNRLKGADKLRLENITQIQPQKLAITLRAGEPQSFNL
KFKRAEDYPIDMYYLMDLSYSMKDDLENVKNLGTSLMQEMTKITSDFRIGFGSFVEKTVM
PYISTTPAKLLNPCTGGLNCTSPFSYKNVLKLTSDGKRFNTLVGKQQISGNLDSPEGGFD
AIMQVAVCGDQIGWRTDVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGKCHLENNMYTMSH
YYDYPSIAHLVQKLSDNNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVINLII
DAYNSLSSEVILENSKLPEGLTIAYTSLCKNGIVSEGENGRKCSNISIGDEVMFTIDVTA
TGCPKMGKPETIKIKPLGFNEEVEITLNFICECDCSSGGIADSQLHLGNGTLECGACKCN
PGRVGRNCECSSNEVATEDMDRTCRRDNSTDLCSNNGECVCGACECKKRDNADERYSGPF
CECDNFNCDRSNSLLCGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCPTGPDIIP
IVLGVVVGIVLIGLALLLIWKLLMVIHDRREFAKFEKEKLNAKWDTGENPIYKSAVTTVV
NPKYEGKF
Download sequence
Identical sequences ENSGMOP00000002985 ENSGMOP00000002985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]