SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003004 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003004
Domain Number 1 Region: 8-159
Classification Level Classification E-value
Superfamily EF-hand 1.65e-45
Family Calmodulin-like 0.000000622
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003004   Gene: ENSGMOG00000002857   Transcript: ENSGMOT00000003099
Sequence length 161
Comment pep:novel genescaffold:gadMor1:GeneScaffold_744:426780:431658:-1 gene:ENSGMOG00000002857 transcript:ENSGMOT00000003099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDIYKAAVEQLTDEQKNEFKAAFDIFVQDAEDGCISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKTEEELAELFRMFDKNADGYIDLEELKVM
LESTGETITEDDIEELMKDGDKNNDGKIDYDEFLEFMKGVE
Download sequence
Identical sequences ENSGMOP00000003004 ENSGMOP00000003004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]