SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003054 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003054
Domain Number 1 Region: 277-435
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 3.05e-30
Family Diacylglycerol kinase-like 0.018
Further Details:      
 
Domain Number 2 Region: 24-134
Classification Level Classification E-value
Superfamily EF-hand 1.92e-21
Family Calmodulin-like 0.011
Further Details:      
 
Domain Number 3 Region: 679-763,797-867
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 2.4e-16
Family NAD kinase-like 0.094
Further Details:      
 
Domain Number 4 Region: 116-184
Classification Level Classification E-value
Superfamily Cysteine-rich domain 9.12e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0033
Further Details:      
 
Domain Number 5 Region: 187-251
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000553
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003054   Gene: ENSGMOG00000002862   Transcript: ENSGMOT00000003151
Sequence length 885
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2262:70090:127336:-1 gene:ENSGMOG00000002862 transcript:ENSGMOT00000003151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLRSSPSPQKGSPMLASPQVVFLKDIVCYLSLLENGTPEDKLEFMFRLYDTDGNGLLDS
SELDRIINQMVHVAEYLEWDSTELRPILKEMMEEIDYDHDGTVTLEEWIRGGLTTIPLLV
LLGMETNVQEDGQHVWRLKHFNKPAYCNYCHTMLLGVRKQGLCCTLCKYTVHERCVSKDI
AACISTYAKSRRHTNAMQHVWMEGNSPTKCDRCHRSIKCYQGLTGLHCVWCQITLHNKCA
SNVKTECDGGAVRDHTLLPSYICPVVLVRFQISPLPGTHPLLVLVNPKSGGRQGERVLRK
LRYLLNPRQVYSLDREGPTVGLNFFHDVPDFRVLACGGDGTVGWILDCIDKANFARYPPV
AILPLGTGNDLARCLRWGGGYEGGSMLKPLRDIEHSIELMLDRWNIDIIAEDKEEKGDPV
PYSIVNNYFSIGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXDASIAHRFHLMREKHPEKFNSRMKNKLWYFEFGTTETISATC
KKLNECIEVECDGIILDLSNTSLEGIAVLNIPSMHGGSNLWGETKKRRNYNRMSKKVPDR
AHSSTVTDVKELKFCVQDLSDQLLEVVGLEGAIEMGQIYTGLKSAGRRLAQCASVIIRTS
RLLPMQIDGEPWMQPPCTVRITHKNQVPMLLGPPQKTPFFFFKKR
Download sequence
Identical sequences ENSGMOP00000003054 ENSGMOP00000003054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]