SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003058 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003058
Domain Number 1 Region: 5-47
Classification Level Classification E-value
Superfamily UBA-like 0.0000000612
Family TAP-C domain-like 0.032
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000003058
Domain Number - Region: 58-125
Classification Level Classification E-value
Superfamily EF-hand 0.0312
Family Polcalcin 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003058   Gene: ENSGMOG00000002911   Transcript: ENSGMOT00000003155
Sequence length 257
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3333:66866:69557:-1 gene:ENSGMOG00000002911 transcript:ENSGMOT00000003155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLKSSQKDKVRQFMIFTQSNEKIALACLSQNEWKLDVATDNFFQNPELYVSNLKGVLD
KRRLEQLYNRYRDPQDDNKIGIDGIQQFCDDLGLDPASVSVLLIAWKFRAATQCEFSKQE
FMDGMTEQGCDSIEKLKAQLPKLEQELKDQGRFKDFYQFTFNFAKNPGQKGLDLEMAIAY
WNLVLAGRFKFLDLWNKFLVEHHKRSIPKDTWNLLLDFSTMITDDMSNYDEEGAWPVLID
DFVEFARPHIGTKSTAV
Download sequence
Identical sequences ENSGMOP00000003058 ENSGMOP00000003058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]