SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003146 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003146
Domain Number 1 Region: 997-1151
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.0000491
Further Details:      
 
Domain Number 2 Region: 418-627
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-43
Family DBL homology domain (DH-domain) 0.00057
Further Details:      
 
Domain Number 3 Region: 1-67
Classification Level Classification E-value
Superfamily Bcr-Abl oncoprotein oligomerization domain 1.96e-28
Family Bcr-Abl oncoprotein oligomerization domain 0.0000617
Further Details:      
 
Domain Number 4 Region: 643-711,768-803
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000158
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 5 Region: 845-915
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000249
Family Synaptotagmin-like (S variant) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003146   Gene: ENSGMOG00000002945   Transcript: ENSGMOT00000003244
Sequence length 1204
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2878:97221:131274:-1 gene:ENSGMOG00000002945 transcript:ENSGMOT00000003244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEPVGFTEAWRAQFPESEPPCMDLNSQGDIEQELNKCKSSIRHLEKEVNKERFRMIYLQ
TILAKERKSYDGQRWGFRKAPQANAGDPPMCPESSQALGEEMARSTQQTRRTVFPRQTEG
DTDCVSPPPQETPDIPVGVGTVAALRCNFERIKRADSVQTEFYVNMEYHQQKGLVRVNDR
DVSDRISALGCQAMQMERKRSLPSFPGHLSAAAADAGRSVLRGRSVEDGCGFGSYDDLTA
RSGGGGTPECVQPYTSVYVGGLMADRVARVVHVRDXXXXXXXXXXXXXXXXXXXXXXXXX
XGYTPDGSSNENLTSSEEDFSSGPSSHVSPSPTSCPVSRGESRSPSQRSLESGSPPTPLA
LKRLQQQALASQALAAHPQTPRTGDTPPSSRTSHDSSLQGDQGSSSSPLRSRSQDTQSSG
SLESALSVELDQEKGLEMRKWVLSGILASEEAYLGHLEALLIPMKPLRAAATTSQPMLST
QQIETIFFKVPELHQIHKDFYDALLPRVQDWSSQRCVGDLFQRLANQLGVYRAFVDNYKV
AVETADKCCQANVQFAEISENLKVKSNKESPKNSLETLLYKPVDRVTRSTLVLHDLLKHT
PACHPDHALLQDALRISHNFLSSINEEITPRRQSMTVKKGENRQLLRDRFMVELVEGSRK
LRHVFLFTDLLLCTKLKKQPAGKAQQYECKWYIPLADLAFHTIDDAESTTIPLVQDEEID
AMKFRISQIKNDIQREKRSAKGLKLLERLRKKLAEQESLLLLTSPNMAFRVANRNGKGFT
FLISSDYERAEWRELVHQQQKKCHKSFSLTSLELQMLTNSCVKLQMVHSVPVIMSKEDEE
SSGLYGFLNVIVHSASGFKHTSNLYCTLEVDAFGYFVNKAKTRVYRDSTEPCWNEEFEIE
LEGSQTLRLLCYEKCCGRTRQSRDEGENTERIVAKGQITLDPQTLQNKDWQRTVITMNGX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRERSKVPLIVRQCVEEIEMRGMEE
VGIYRVSGVATDIQGLKAAFDSNNKDVSVVMREMDVNAIAGTLKLYFRELPEPLFTDDLY
PSFSGGLALSDSVAKESCMLHLLLSLPEANLVTFLFLLDHLKRVAENEGVNKMSSYNLAT
VFGPTLLRPSEKDSRAGSSQPLSMNDSWSLEVMSQVQLLLYFLQLENIPAPDSKRQSLLF
SSEI
Download sequence
Identical sequences ENSGMOP00000003146 ENSGMOP00000003146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]