SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003170 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003170
Domain Number 1 Region: 98-207
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000114
Family Second domain of FERM 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003170   Gene: ENSGMOG00000003006   Transcript: ENSGMOT00000003269
Sequence length 437
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4263:5382:11974:1 gene:ENSGMOG00000003006 transcript:ENSGMOT00000003269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQDVVIYGGGLAVPLTVEGLGVVSVQELARDVRQALRIPEANQDAFALWLCSPLLELQLK
PRHQPYKLCRQWQDLLYRFTEASAEDISQDEPCLQYRRNVFYPKSKELLVEDQGVLRLLY
EEARGNILSDRYPCDPDHWTGLGALALALDEGPHLDXXXXXXXXXEKKLVSFLPASVAFG
AGGLLSTLRGRGRRQAALEHKLLDEYRKPAGASDGPSLLXXXXXXXXXXXXXXSAFFPGE
IDRPAQGLLQRGRRKVVSVGISLDGVYVMDVKEKHVLLGLLFSQLSWDHSYPEEEGDSHV
LWLEFDGEEDGTAVNKLLKIYSKQAELMSGLIEFCVELSSPSGGVASAXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEIKRLKPRRAASFFSRQN
TAPAYATVQGGDGLEQG
Download sequence
Identical sequences ENSGMOP00000003170 ENSGMOP00000003170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]