SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003245 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003245
Domain Number 1 Region: 68-189
Classification Level Classification E-value
Superfamily Second domain of FERM 4.84e-42
Family Second domain of FERM 0.00000116
Further Details:      
 
Domain Number 2 Region: 1-66
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.96e-22
Family First domain of FERM 0.00014
Further Details:      
 
Domain Number 3 Region: 190-224
Classification Level Classification E-value
Superfamily PH domain-like 0.000000713
Family Third domain of FERM 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003245   Gene: ENSGMOG00000003092   Transcript: ENSGMOT00000003346
Sequence length 225
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2113:5391:15824:1 gene:ENSGMOG00000003092 transcript:ENSGMOT00000003346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GIIQKILDIHKVRWTACFGLRLTNSQSADEVHWLHPDLGVSHVRENYEQPQPQEEWRYEL
RIRYLPKGFLQQFTEDKTTLNYFYQQVKNDYMTEKGDQVDQDVALKLGCLEIRRFFREMR
GNALDKKSNYELLEKDVGLRRFFPKNLLDSVKAKTLRKLIQQTFKQVANLNDEQSIMKFL
EILSPVYRYDKECFKCALGLSWVIQVELAIGPEEGISYLTDKGST
Download sequence
Identical sequences ENSGMOP00000003245 ENSGMOP00000003245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]