SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Gadus morhua 69_1 > ENSGMOP00000003245

Domain assignment for ENSGMOP00000003245 from Gadus morhua 69_1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSGMOP00000003245
Domain Number 1	Region: 68-189
Classification Level	Classification	E-value
Superfamily	Second domain of FERM	4.84e-42
Family	Second domain of FERM	0.00000116
Further Details:

Domain Number 2	Region: 1-66
Classification Level	Classification	E-value
Superfamily	Ubiquitin-like	1.96e-22
Family	First domain of FERM	0.00014
Further Details:

Domain Number 3	Region: 190-224
Classification Level	Classification	E-value
Superfamily	PH domain-like	0.000000713
Family	Third domain of FERM	0.00043
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSGMOP00000003245 Gene: ENSGMOG00000003092 Transcript: ENSGMOT00000003346
Sequence length	225
Comment	pep:novel genescaffold:gadMor1:GeneScaffold_2113:5391:15824:1 gene:ENSGMOG00000003092 transcript:ENSGMOT00000003346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	GIIQKILDIHKVRWTACFGLRLTNSQSADEVHWLHPDLGVSHVRENYEQPQPQEEWRYEL RIRYLPKGFLQQFTEDKTTLNYFYQQVKNDYMTEKGDQVDQDVALKLGCLEIRRFFREMR GNALDKKSNYELLEKDVGLRRFFPKNLLDSVKAKTLRKLIQQTFKQVANLNDEQSIMKFL EILSPVYRYDKECFKCALGLSWVIQVELAIGPEEGISYLTDKGST
Download sequence
Identical sequences	ENSGMOP00000003245 ENSGMOP00000003245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]