SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003261 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003261
Domain Number 1 Region: 7-144
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 1.24e-56
Family FAT domain of focal adhesion kinase 0.000000367
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003261   Gene: ENSGMOG00000003108   Transcript: ENSGMOT00000003362
Sequence length 145
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2113:38884:39664:1 gene:ENSGMOG00000003108 transcript:ENSGMOT00000003362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQLQPQEISPPPTADLDRSNDRVYENVTGLVKAVIEMSYRIQPAAPEEYVAMVKEVGLAL
RTLLATVDETIPELPASTHREIEMAQKLLNSDLSELIGKLKLAQQYVMTSLQKEYKKQML
TAAHALAVDAKNLLDVIDQSRLKMI
Download sequence
Identical sequences ENSGMOP00000003261 ENSGMOP00000003261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]