SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003329 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003329
Domain Number 1 Region: 885-1163
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-67
Family Protein kinases, catalytic subunit 0.00000573
Further Details:      
 
Domain Number 2 Region: 586-878
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.39e-42
Family Protein kinases, catalytic subunit 0.0003
Further Details:      
 
Domain Number 3 Region: 437-563
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000789
Family SH2 domain 0.0077
Further Details:      
 
Domain Number 4 Region: 152-282
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000115
Family Second domain of FERM 0.0056
Further Details:      
 
Domain Number 5 Region: 373-442
Classification Level Classification E-value
Superfamily PH domain-like 0.000000688
Family Third domain of FERM 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003329   Gene: ENSGMOG00000003132   Transcript: ENSGMOT00000003431
Sequence length 1171
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1472:5715:79364:-1 gene:ENSGMOG00000003132 transcript:ENSGMOT00000003431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTLGMMEQLSRQLCGKMKRSGKRTPIPSSPASPSPKGLEVHFYLADTNQLEYFRDCHTT
EDICVESAKRCSISPLCHNLFSLYDETNDLWYPPNHEFKITEETSLTVHYRMXXRFYFKN
WHGTNEGQPQVWRHCISKLRGGSQNIPEGTPLLDAASLEYLFAQGQHDFQKGLAPLRSPQ
SEVDQHEMENECLGMAVLAITHDSMNRDIPLTTTNTNEISYKRFIPESLNRNIKQRNLLT
RMRISSVFKKFLQEFKQRTVQDSNISLYDLKLKYLATLESLTWDLGSEVLEPVSLSISPD
RDLCNGGYHGYYNQSQGQSKDPSPESSNDMQVQVTGTTGISWRKKPSNXXXXXKEKNKAK
KKFDDKYKKEKEKAESWVVFCDFHEITHIVIKDATVTIYRQDNKRMELQLASRARARALS
FVALVDGYFRLTVDAHHYLCKDVAPSSVARNTDDGCHGPICTDYAVHKLRQEGNQEGTYI
LRWSCTEYQFIIITVVCRELDLRESRMVTQYKNFQVEVSPSGFCLYGTETIRPTLRELLD
HLAGQSLRADNIEFQLIRCCPPQPREVSNLLVVTKKQPALQDDCQVSFIRILPEDIEQEE
HLGRGTRTNILLGTLRVRGEEDDEDAGLSSYQEVKVVLKVLGSIHRDISLAFFETASMMR
QVSHKHIVLLHGMCGRNLENIMVEEYFQLGPLDQFMMRQQVPLSTLWKFQVATQLASALS
YLEDKKLVHGFVCTKNILLARDGLDVSEGGPFIKLSDPGIPITVLTREECVGRIPWIAPE
CIKTVNNLSVAADKWGFGTTLWEICYNGEVPLKDKMLTEQKEQFYSAECQLATPDCEELA
QLMTHCMNYDPKMRPFFRAIVRDMDMLVEQNPSIKPVPTQEVDPTRFEKRFLRKIRDLGE
GHFGRVELCRYDPRGDRTGEMVAVKSLKPENREEQNNNLWKEIGILKELYHENIVKYKGI
CQEEGSPAIKLIMEYLPEGSLKDYLPRHRNKTIMTSYAVQICKGMEYLGRQNYIHRDLAA
RNVLVENESTVKIGDFGLTKSIKENKTYYKVNDDHDSPVFWYAPECLLQRKFFLASDVWS
FGMTLYELITYCDTHSSPMALFLKMMGKTHGQMTVTRLVTILDEGKRLPRPEPCPEEVYN
LMRKCWEHAPDMRITFQQLIEDLSRMLQKPA
Download sequence
Identical sequences ENSGMOP00000003329 ENSGMOP00000003329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]