SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003509 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003509
Domain Number 1 Region: 2-70
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.97e-17
Family DBL homology domain (DH-domain) 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000003509
Domain Number - Region: 103-167,261-298
Classification Level Classification E-value
Superfamily PH domain-like 0.000209
Family Pleckstrin-homology domain (PH domain) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003509   Gene: ENSGMOG00000003312   Transcript: ENSGMOT00000003614
Sequence length 298
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1432:45215:57136:-1 gene:ENSGMOG00000003312 transcript:ENSGMOT00000003614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTLYGLMMKPIQRFPQFILLLQDMLKNTPVGHGDRLPLQMALTELETLAEKLNEKKREAD
QRCEIRHIAKAMNERYLNKLLSNGSRHLIRSDDMVETVYNERGEIIKTKERRLFLLNDVL
MCATPNIRCSQDGSGGGAIGNAPPGHKFLLKWSVPLGLVDVVEFGSSEDVPATGRHPGAQ
HHSGEKVVINAKPSKLYMGPGQLYQDLQNLIHDLSLVNQISSMIGSLKGIYQNVNPAVAQ
DWMSGLQRLILKKEEEIRAADRCRIQLQLPGKHDKMGKPTYFSAVFNTFSPAIKQSWI
Download sequence
Identical sequences ENSGMOP00000003509 ENSGMOP00000003509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]