SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003526 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003526
Domain Number 1 Region: 288-463
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 3.84e-74
Family Mammalian PLC 0.000012
Further Details:      
 
Domain Number 2 Region: 131-286
Classification Level Classification E-value
Superfamily EF-hand 9.89e-40
Family EF-hand modules in multidomain proteins 0.033
Further Details:      
 
Domain Number 3 Region: 2-113
Classification Level Classification E-value
Superfamily PH domain-like 2.85e-27
Family Pleckstrin-homology domain (PH domain) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003526   Gene: ENSGMOG00000003332   Transcript: ENSGMOT00000003632
Sequence length 495
Comment pep:novel genescaffold:gadMor1:GeneScaffold_258:136766:141257:1 gene:ENSGMOG00000003332 transcript:ENSGMOT00000003632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VERCMCTMQSGSQMIKLKGKKKGLNRFFYLDEHRSCIRWRPSRKHDKAKITIDSIHEVCE
GKKSEIFQRYADNRFDPNCCFSIYYGERVKSLDLVSTNGEDARTWITGLKYLMAGISDED
CLARRQRTRDQYFMWLQQTFSEADKNGDGTLSIGEVHQLLHKLNVNLPRQKVREMFKMAD
TDENQGSLGFEEFCSFYKMISTRRDLYLIMISYSNHKEVLDLSDLARFLEIEQKMVGLPR
EHLLEIVAHFEPCPENLQHMVLGIDGFTNYMRSPAGDIFNPEHHTVNQDMTQPLCNYYIS
TSHNTYLTGDQLLSQSRVDMYAYVLQAGCRCVEVDCWDGPDGEPIIHHGYTLTSKILFKD
VIETINKYAFIKSQYPVILSIENHCTVPQQKKMAQYLMEVLQDKVDLSHINMNECRKLPS
PEILKGKVLVKGKKLPANLDPEVEEGDVSDEDTGDDEEEDDEDDDTQKNRKKSMKGKRRT
SSVGETHPGIHSQNE
Download sequence
Identical sequences ENSGMOP00000003526 ENSGMOP00000003526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]