SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003622 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003622
Domain Number 1 Region: 128-244
Classification Level Classification E-value
Superfamily EF-hand 7.14e-28
Family Osteonectin 0.015
Further Details:      
 
Domain Number 2 Region: 217-311
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.06e-25
Family Thyroglobulin type-1 domain 0.00076
Further Details:      
 
Domain Number 3 Region: 71-115
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000154
Family Ovomucoid domain III-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003622   Gene: ENSGMOG00000003415   Transcript: ENSGMOT00000003731
Sequence length 320
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3666:96451:110601:1 gene:ENSGMOG00000003415 transcript:ENSGMOT00000003731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLQEPGTWTPSKPMDQGLDPAKDPCLKIKCGRHKVCVAEDYKTATCISQRRVXXXXXXXX
XXLFQSPGSKCEPCPVVHPSPVCGTDGHTYSSKCKLDYQACMSGKKISEKCAGMCPCTTL
PEHSSAEPVCSESDLKEVVSRLREWFRVLHENGSHKRTKAPKPDQSKFGLGALPICKDPL
GWMFSRLDTNFDLQLDQSETRSLYLDRNEPCSEALFRSCDVRRDQLLSSSEWCTCFQRHT
DSPCKVELSNVNKKQAGKKLLGQYLPACDEEGYYRTHQCHGSSGQCWCVDRYGNEASGSR
THGPADCGVVLESSGDPGSG
Download sequence
Identical sequences ENSGMOP00000003622 ENSGMOP00000003622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]