SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003623 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003623
Domain Number 1 Region: 189-260
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 6.02e-19
Family Thyroglobulin type-1 domain 0.0015
Further Details:      
 
Domain Number 2 Region: 313-378
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000553
Family Osteonectin 0.03
Further Details:      
 
Domain Number 3 Region: 11-55
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000263
Family Ovomucoid domain III-like 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000003623
Domain Number - Region: 58-94
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.000144
Family Thyroglobulin type-1 domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003623   Gene: ENSGMOG00000003419   Transcript: ENSGMOT00000003732
Sequence length 382
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2404:154:5034:1 gene:ENSGMOG00000003419 transcript:ENSGMOT00000003732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QWLIGDRDGPCGAACSRTQGRPVCGSDGRSYDTSCELQRARCKNRTLTLAHRGRCRDGGQ
SKCRMERSQALGQAHRPQESMFVPECNEDGSFAQXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXSVTDRPPGPPSSGRKDDGSKPTPTLESHALTDGDXXXXXXXXXXXXXXXXXX
XXXXXXXXXASSCDQEQQSAQEEARQHKNEAVFVPDCALGGLYKPVQCHPSTGYCWCVLV
DTGRPIPGTSTRYQAPECDSNARSHVSDTEDPFQGRELTXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXEGALRWHFERLDVDASGALSEREARPLRQFLRRRLKPRRCAKKFAQ
YCDRDQDRSLTLGELSACTCKD
Download sequence
Identical sequences ENSGMOP00000003623 ENSGMOP00000003623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]