SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003641 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003641
Domain Number 1 Region: 43-241,282-364
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 4.74e-49
Family Diacylglycerol kinase-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003641   Gene: ENSGMOG00000003440   Transcript: ENSGMOT00000003751
Sequence length 377
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1654:9050:58311:1 gene:ENSGMOG00000003440 transcript:ENSGMOT00000003751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVSYVQRARRAAWRLRDVTFLCADAALCGRWVRTLTEQLSALLLVYINPLSGKRHGERIY
RHKVAPLFSRANISTSVIVTQHANHARDHLRTEAELQNYDGVVCVGGDGMFSEVMHGLVL
RTQRDQGRDHHHPDQDLPRPLRIGIIPAGSTDCICFATVGANDPVTSSLHIIVGDCQPMD
VCSVHHGDAFLRYSVSLLGYGFYGDVLSDSERRRWMGPARYDVSGVKKFLSHRYYEGTVS
YLPASDVLGTPRDRAPCRTGXXXXXXXXXXXXXXXXXXXXXXXXXXXGKFLAINAVSMSC
ACPRSPQGLSPAAHLADGTTDLILVRKASRLAFLRHLLRHTSKDDQFDLGFVEVHRVRRF
RFTPRFCQSDSELDLQE
Download sequence
Identical sequences ENSGMOP00000003641 ENSGMOP00000003641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]