SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003721 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003721
Domain Number 1 Region: 141-326
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-59
Family Phosphotyrosine-binding domain (PTB) 0.000000124
Further Details:      
 
Domain Number 2 Region: 512-571
Classification Level Classification E-value
Superfamily SH2 domain 3.1e-18
Family SH2 domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003721   Gene: ENSGMOG00000003506   Transcript: ENSGMOT00000003832
Sequence length 574
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4501:880921:896773:-1 gene:ENSGMOG00000003506 transcript:ENSGMOT00000003832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHRTKYNRFRNESVTSVDDLLHGLSMNSKVSAAPSPASAVXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXDRTPGRGGGGLVSKPPRGWLHSSEKISGPGVTYIVNYLGCIE
VLRSMRSLDFTTRSQITREAISLVCEAVPGTKGAPRKRKPPSKALSNILGKSNLQFAGMS
INLNISTSSLNLMTPDSKQIIANHHMQSISFASGGDPDTTDYVAYVAKDPVNRRACHILE
CSDSLAQDVISSIGQAFDLRFQQYLQCPSSKPSSTHDRVLNMEEFPWTEEEEEPAEHPYY
NNIPGKMPPPGGFIDSRLAGQGGASDGGQDPAYYQGRHCGESWGEEKTPSLVTQGSTDTY
SLPETKGQASKAGEMPTYVNTQQIDAQVLAVLQAEADHSPQKDLFDMXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXLARAVAPRGQEELGGQAWYHGQMSRRDAEKLLRDDGDFL
VRKSTTNPGSYVLTGMHHGLAKHLLLVDPEGTVR
Download sequence
Identical sequences ENSGMOP00000003721 ENSGMOP00000003721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]