SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003738 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003738
Domain Number 1 Region: 1-339
Classification Level Classification E-value
Superfamily Sema domain 9.29e-113
Family Sema domain 0.00000000154
Further Details:      
 
Domain Number 2 Region: 342-372
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000017
Family Plexin repeat 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003738   Gene: ENSGMOG00000003536   Transcript: ENSGMOT00000003852
Sequence length 386
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4501:909963:916881:-1 gene:ENSGMOG00000003536 transcript:ENSGMOT00000003852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDGRGKCAFDPSHSVTTVMVDGELYSGTVYNFLGSEPIISRYSPQQALLRTEYSTSWLNE
PSFVFADVIREGGGPAGEDDKIYYFFTEVSVEYEFFGKLFIPRVARVCKGDLGGQRTLQK
KWTSFLKAKLVCSMPELNFVFNVVHDVFVLEAEDWRNTLIYAVFTSQWGNVGLSAVCVYN
MALVDEVFSKGKYMQKATVEQSHTKWVRYNGITPSPRPGACIDNAMRQENINSSLHLPDK
TLQFVKDHPLLEDPVLPVGGRPHLITKDVNYTQIATGRRWTVAPTTSSSPAPSVLDEGEV
HVVEEIQLIKSGGAIKNLLLSSETRSLYAGSDSGVVQSPTAFCGKYLSCDQCVLARDPYC
AWDPSSSACVNILIQSLKGDADSCPA
Download sequence
Identical sequences ENSGMOP00000003738 ENSGMOP00000003738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]