SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003796 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003796
Domain Number 1 Region: 237-435
Classification Level Classification E-value
Superfamily MIR domain 1.05e-60
Family MIR domain 0.0000000831
Further Details:      
 
Domain Number 2 Region: 437-602
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 5.75e-55
Family IP3 receptor type 1 binding core, domain 2 0.000000274
Further Details:      
 
Domain Number 3 Region: 1120-1279
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 5.36e-31
Family IP3 receptor type 1 binding core, domain 2 0.01
Further Details:      
 
Domain Number 4 Region: 109-219
Classification Level Classification E-value
Superfamily MIR domain 4.97e-20
Family MIR domain 0.017
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000003796
Domain Number - Region: 1906-2038
Classification Level Classification E-value
Superfamily ARM repeat 0.023
Family Armadillo repeat 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003796   Gene: ENSGMOG00000003496   Transcript: ENSGMOT00000003912
Sequence length 2685
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1479:23964:109244:-1 gene:ENSGMOG00000003496 transcript:ENSGMOT00000003912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEHRSSFLHIGDIVSLYAEGSVHGFISTLGLVDDRCVVQPEAGDLANPPKKFRDCLFKV
CPMNRYSAQKQFWKAKQGKQGNTNTQGELFKKLQHAAELEQKQNDSENKKLLGEVVKYSN
VVQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDPAGNEGSWFYIQPFWKLRSEGDNVVVG
DKVVLMPVNAGQPLHASNIELLDNTGYKEVNAVNCNTSWKVALFMKFSDYREDVLKGGDV
VRLFHAEQEKFLTGDEYKKKQHVFLRTTLRQSATSATSSKALWEIEXXHYDPCRGGAGQW
NSLFRFKHLATGNYLAAEGNPDFKDEPVETKGESETETLFSKRKRQAADKINFVLVSVPH
GNDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTNFPIDTEEERPVMLKIGT
CSTKEDKEAFAIVSVPLSEVRDLDFANDANHVLESTVRKLQYGNIAQNERRFVTKLLEDL
VFFVCEAVNNGQDVLSVAICRPNRERQKLMREQNILAQIFGILKAPFTDLGDGPMLKLED
LGDQRYAHFKYMLRLCYRVLRHSQQDYRKNQEYIAKKFSIMQSQIGYEILAEDTITALLH
NNRKLLEKHITAKEIETFVNLLRRNREPRFLDYLSDLCVSNNTAIPVTQELICKFMLNPN
NADILIQTNPPPSPPLLSSPRLIPNTENSLESSLWLYWIDGHKEPHGKSIRHLAQDSKGH
NKMDTDIITYYRXXXNLFAKMCLDRQYLAINQVSTQLPVELILRCMFDDCLPYNLRASFC
RLMLHMHVDRDPQEAVVPVRYARLWTEIPSKITIHEYEYDATDSPREEMKRKFSPTMEFV
EEYLRDVVNQPFPFGDNEKNELTLEVVNLARNLVYFGFYSFSELLRLTRTLLAILDIVQY
PLAYVNKLNKSPEAGNNVLRTIHGVGEMMTQMVMSRGLPNSLPDSPPSLRLGKGHLCPDN
EDVMVMDTKLRIIEILQFILSVRLDYRISYLLSVYKKEFDKESVSESSLSMNDIPPVLPS
EPDIDEIASKAEAMFAGSSERSTVELDDEGGRTFLRVLIHLIMQDYPPLVSGSLQLIFKH
FSQRAEVLQAFKQVQLLVSEQDVENYKQIKTDLDQLRLTVEKSELWVEKSGGYSGDDQAS
RQAMELNNEVTYHXXXISPVQDGDIKPHIDGNKANNYNIVKEILLRLSKLCYPGKKSRIQ
QQRLLKNMGAHTVVLDLLQIPYETSDGKMNEIMTLAHAFLQNFCRGNTQNQILLHKHLNL
FLTPGLLEAETMRHIFMNNFQLCNDISDRVVHHFVHSIETHGRHVQFLRFLQTIVKADGK
YVKKCQDKVMTELVNGGEDVLVFYNDRSSFPLLLQMMGCERERSDEGGALAYHNTLVELL
AACTEGKNVYTELKCNSLLPLDDIVKVVNDVHCIPEVKTAYVNFVNHCYVDTEVEMKEIY
TSNHIWKLFDNFLVDMASVCNSTTERSHADLALEKYVTESVMAIVKGFFGSQFSVNNSNL
QTNQPVFIQLLQSAFRIYNCTWINSAQKANIESCIKTLADVAKARAIAIPVDLDSQVNTL
SLKVHSNMVQRAAKDWRISARTRPRKETFGGPDYKIIIEKLQNVVTCLEEQFSPKVQAEF
SVLVDVLHSPELLFPEAARLRCESGAFMSKLIKHTNKLMDKEEKLCIKILQTLREMLDKK
ESFHEAGSALRRSLLTRYFGSQKCLLSEFGSGTSPSGGFQVGFPVLDSDKPGSSMVEIQC
LLDSVGASELVIDLIVNTKNDRVFEESIQFGIALLKGGNTKIQNSFYHQLFKQKKSERFF
KVFYDRMRLAQQEIRATVSVNMFELSTRKRDDDGSDATALHLKKQMRENMRGQLKEASSA
TSKAFCAFRKELDPELECLNQGSEGSAAGEALEDTQMSQAIAIMKPILRYMQLLCENHNT
NLQNFLRNQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEGNVDLVRQTLETITE
YCQGPCHENQSCIAKHESNGIDIIIALIVNPINPLGKHRLDLVMELKNNASKLLLAIMES
RHDSENAEKILYKMRPNELVDVMKEAYAQGVEAELDGEVFGDQIKPKDVGHNIYILAHQL
SRHSKEMQLLLREGTAVPLGVEPEEDYEGDALRYYANHTAQIEIVRHDRSMEQLVFPVPN
ICEYLTLESQVRVFSTTERDDQGSKVNHFFQQFDHLYNEMSWQKKIRKNKALFWFSRHIS
LWGSISFYLACLLNIAVAVFYPFGDDGDEGTLPPFWNVLLWVAVGVFTSLLPVLPKPWGI
LFFLVSLILRSIYTLGLGPALLLLGAANLFNKVVFLVSFMGNQGTFTRGYQAVVMDMLFI
YHLGYAVICVLGLFAHEFFYSFLLFDLVIREETLLNVIKSVTRNGRSIILTAVLAIFLVY
FFSIIGFLFLKDDFRMEVDRLPAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXDGTERVCDTLLMCIITVLNQGLRNGGGVGDILRRPSKEEPLFAARVVYDLLFFFI
VIIIVLNLIFGVIIDTFADLRSEKQRKEEILKTTCFICGLERDKFDNKTVSFEEHIKAEH
NMWHYLYFLVLVRVKDPTEYTGPESYVAYMIKENNLDWFPRMRAMSLVSSESDGEQNEMR
GLQEKLVGTITLVLQLSGQLAELKEQMTEQRKNKQRMGFLGTPQG
Download sequence
Identical sequences ENSGMOP00000003796 ENSGMOP00000003796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]