SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003840 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003840
Domain Number 1 Region: 844-1125
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-69
Family Protein kinases, catalytic subunit 0.00000904
Further Details:      
 
Domain Number 2 Region: 552-850
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.54e-43
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 
Domain Number 3 Region: 407-513
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000128
Family SH2 domain 0.0056
Further Details:      
 
Domain Number 4 Region: 347-412
Classification Level Classification E-value
Superfamily PH domain-like 0.000000541
Family Third domain of FERM 0.031
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000003840
Domain Number - Region: 125-223
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000303
Family Second domain of FERM 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003840   Gene: ENSGMOG00000003606   Transcript: ENSGMOT00000003957
Sequence length 1146
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1876:130270:138390:1 gene:ENSGMOG00000003606 transcript:ENSGMOT00000003957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDGNSTSRRCEPPKSLGIHIYLLWTKEGDRYHSHSVGDVTAEELCMSVAEAVGITPLCSV
LFALYDPLACCWYSPNHVFTPDKTSLVLHYRMRFYFRNWHGLNDKETTVSRYAPRSGSEQ
GPSPLLEQTALEYLFSQAKYDFVNDVVPMEEAETDEQLNQLQNESLGMAVLHLSHEAARR
ECSITEVSDKISFLDCIPKSFSQHIGRNNFLTRLRINRVFANFVRNFQRQTADNGRLGFQ
DVMYKYIYTLEHLAPNFATETFSVSHMATKRDGYGGGSNSHSFYAYGNSTSNIDALLAHE
VLVSGTKGILWRKSLGQKARENSYFRKDYIKKKAKQQNNQPNDNRAKEWQHFCDFPEISH
ITISGEAVCISTQDNHSMEVHMNSTLEARSFISLLDGYFRLTADAHHYLCHEVAPPRVVM
SAANGLHGPMQEEFAMLRLKKEAMEDGVFLLRWSALDYHRILLAVMNSRADGSTSVHKQF
RILQRGSKYSLESWDQEFSSVKELIEGLRSLVLRSGADSFTLKKCCLPRTAELSNLLLVR
DKSIHPSSSDVPHMRFHQIKVKDIVQEQHMGPGTWTNIFSGRFLVTGEGNDEDEEYNNNL
NDPKGNRVVLKILDQSHKEMSFAFFDTASLMSQVSHNHLVFVHGVCVGTEIIMVEEFVEF
GPLDVFLRKERASVSPQWKFIAAIQLASALSYLESKKLVHGNVCAKNILVARRGLEHQTT
PFVKLSDPGIALNVLSREERLERIPWIAPECVQSGAPIGNTADQWSFGVTLLEICNNGDV
PMSGFTYLEKEQFYQQKGRLVEPQSPELASFISMCLTYEPVERPSFRTVLRELSNSPSTM
LWVINPNIAPSGPFTILDQSVFHKRYLRKMRDLGEGHFGKVTLCMYDPNNDGTGEHVAVK
ALKHDGGGNQHECWLKEIDILKSLYHANIVKYKGCCTELGGKVVQLIMEFLPLGSLKEYI
IGCKIGVPQCLLFAGQICQGMEYLQSKRYIHRDLAARNVLVENDNLVKIGDFGLTKHIPE
EKEYYRVRDDGESPVFWYAVECLRESKFSFSSDVWSFGVTLYEILTRCDPAMNPPKMVVT
ALISLLERRKTLPCPKDCPHEVYMLMKQCWNVEPGQRPSFKSLIESIATIRQSYEGQPNG
NVSLRH
Download sequence
Identical sequences ENSGMOP00000003840 ENSGMOP00000003840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]