SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003875 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003875
Domain Number 1 Region: 12-188
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.68e-32
Family DBL homology domain (DH-domain) 0.00055
Further Details:      
 
Domain Number 2 Region: 207-347
Classification Level Classification E-value
Superfamily PH domain-like 3.24e-19
Family Pleckstrin-homology domain (PH domain) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003875   Gene: ENSGMOG00000003652   Transcript: ENSGMOT00000003992
Sequence length 372
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1479:132092:140553:1 gene:ENSGMOG00000003652 transcript:ENSGMOT00000003992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVFLATLENLQARHCLVDLDPWRLFANINELCLVSFGFLKSLLRVVKDTWELPPEGAGAC
LPELLSQAFQERVCHCLQKYCLNYSAALQYLDCLKAREDFGCYLKWCERKEQCRRLQLRD
LLVAPMQRLTRYPLLLRNMAKRSAGAEGAALQAVAEQVDASICNLEGEVKWLDNYQQVKQ
LRDALVWLPVWERDKRAFVPESLKHLLKTVTLDNLINHRSLLHDGKLIATENTKMVDVYL
FLFDEFLLITKIKRNKKRSAAPEQAQSPDLDQLLKEGCTFTVVDQPVSLDRLHMKNIDQL
NATASGLPHSFILMHQSRYQQCMGAFILQAPCDAVKKAWMSKIEGAVTALLKLDSQQPRV
KNASRWLESSQI
Download sequence
Identical sequences ENSGMOP00000003875 ENSGMOP00000003875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]