SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003893 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003893
Domain Number 1 Region: 448-471
Classification Level Classification E-value
Superfamily Notch domain 0.0000863
Family Notch domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000003893
Domain Number - Region: 935-1011
Classification Level Classification E-value
Superfamily EF-hand 0.00306
Family Parvalbumin 0.066
Further Details:      
 
Domain Number - Region: 519-542
Classification Level Classification E-value
Superfamily Notch domain 0.00706
Family Notch domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003893   Gene: ENSGMOG00000003643   Transcript: ENSGMOT00000004011
Sequence length 1227
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4097:10853:32729:1 gene:ENSGMOG00000003643 transcript:ENSGMOT00000004011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLLKLLQRQTYTCLSHRYGLYICFGGLVLMIVSAFQFGEVLVEWSRDQYHVLFDSYRDNI
GGKSYQSRLCLPMPIDVVYTWVNGTDIALLKQLKTVREQLEKEQRAIRERLGKNASVTTE
VPNNRAKQECLLTHCIVAPMLALDPALPANVTVKDLPSLLSPSFSTAKELMLVTQPFPPS
TTVSVLIFHSQAEADKAYKDTSGEDLKHSISRCYLTADREAPGLVSMQSLAYLSGFPSTF
KDTEQLRAKLPSVITSKIKEFELYSEASIALLHLNGPQDFSDLSQQARKNLTLDGKELTI
GPAYLFWDLTAISQSKRDEDVSASRFEDNEELRYSLRSVEKHAPWVRHIFVVTNGQIPSW
LNLDNSRITVVAHQDIFQNQSHLPTFSSPAIETHIHRIPGLSQKFIYLNDDVMFGKDVWP
DDFYSHSKGQKVYLTWPVPNCAEGCPGSWIKDGYCDKACNNSACDWDGGDCLXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQGCANSWLADKFCDQACNVLACGFDVG
DCGKDRFDQMHRVAMRRNQSLYTVPRGELRPYLSFEGVARRVSEATVGEHAVVRHTSVAN
KWKTLHLLLLPGHNATRVHYNLTCQGDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXTFADSLRHVNRLLNGQFGFTSRKVPAHMPHMIDRLVMQELQDTFPLDFDRTSEHRVRH
SEDMQFAFSYFYFLMSALRQLDVARVFQEIDTDRSGVLSDREIRTLATRVHELPLSLQDL
TSLEQMLINCSKTLPSNLTQLDAVSPSQESYYDPSMPPVTKGLVLHCKPITELIHKAFKD
QNKYKFEIMGEEEIAFKMVRTNVSHVVGQLDDIRKNPRKFICLNDNIDHGHKDASTVKAV
LRDFYESMFPLASQFELPREFRNRFLHMDELQEWRVYRDKLKFWTHCVLVTLVVFTVLSF
FAEQLIQLKRRLFPRRRVSQENNSERV
Download sequence
Identical sequences ENSGMOP00000003893 ENSGMOP00000003893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]