SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004005 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004005
Domain Number 1 Region: 87-192
Classification Level Classification E-value
Superfamily Immunoglobulin 3.81e-16
Family V set domains (antibody variable domain-like) 0.025
Further Details:      
 
Domain Number 2 Region: 14-72
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000671
Family V set domains (antibody variable domain-like) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004005   Gene: ENSGMOG00000003771   Transcript: ENSGMOT00000004126
Sequence length 229
Comment pep:novel scaffold:gadMor1:scaffold11849:26672:27701:1 gene:ENSGMOG00000003771 transcript:ENSGMOT00000004126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKLLYIVAKKERKILWYKQSIGYVPQKVALIVDAYSEISPFRFNFTAAEPDTDLNIRSAS
KEDEAYYFCRALQRITGLFLSVKGKSQTVVQQPVSASAQLGDPVALQCSVTTKRTDQSNQ
CQGEPSVYWFRSGPSQPAAIYMKETGVVNTSCVYTLPKNNVDSSDAGTYYCALAACGEVV
FGNGTKLDLRPNLIPGPNLVPAIVVLGILLACCLVVIIILLLTRNKKQV
Download sequence
Identical sequences ENSGMOP00000004005 ENSGMOP00000004005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]