SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004042 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004042
Domain Number 1 Region: 615-742,788-962
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.31e-77
Family Protein kinases, catalytic subunit 0.000000000765
Further Details:      
 
Domain Number 2 Region: 471-555
Classification Level Classification E-value
Superfamily Immunoglobulin 1.27e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 167-253
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000383
Family I set domains 0.028
Further Details:      
 
Domain Number 4 Region: 264-297,328-365
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000775
Family I set domains 0.08
Further Details:      
 
Domain Number 5 Region: 382-460
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000117
Family V set domains (antibody variable domain-like) 0.053
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000004042
Domain Number - Region: 27-57
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000693
Family I set domains 0.039
Further Details:      
 
Domain Number - Region: 116-152
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0577
Family I set domains 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004042   Gene: ENSGMOG00000003756   Transcript: ENSGMOT00000004165
Sequence length 1138
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3590:362953:400967:-1 gene:ENSGMOG00000003756 transcript:ENSGMOT00000004165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTDKLHWVLHVPSSDGVVVEDCEPNQNPHCSKLTLRHLQAGDTGTYTCSYSQPFAVYVYV
KATIFPEEEWDPKVGFKISYPPTISNHMLICETWVNGQGFQLQYVPQRLTHLFNRVKLIP
DSQRVLVGVNLTLNCSGETNYNGRISFEWHIHPFLHLSYRNYQDGYVTVTEGNKLVFRPV
VDALPSADSVAWHKDGVPILRNSTCYKISGFNLTVADIQYKHTGVYTITVGNVEKGLYRN
LSYTLVVHVSPTISEEGLSNVDVQPYMYGKEHRLTCTVFAVPRPKISWFWQPCRLEADIT
ECEFYTEPIPVELESRGDYPRNWIAAMYTRIKMVQGKNKTVGTLVVGRANVTGSYTCRAE
NEGLKEVGIPFYVDDHSDHMHIEPQTAIEGEDITLTCRATRYLYSELQWFDPQNRTVTAD
VSPLRLDPYSVSLALTLRNVSRNGGTPAYRCGALNHFKHKSAHKRKRPWLSQNLTNQEVN
SSSTLTLDCLVSGVPKPLITWFKNNIQVQEGPGITLGESGVLTIERVKKEDEGLYECLAS
NVEGSIRTSAVVMVSGEDGRANVEVIILVCTGAAATFLWIMLILFIRKLRKLQQPSHYKM
GPSIIIDPDKYPLDEQDELLQYDSSKWEFPRDRLRLGKTLGHGAFGKVVEASAFGIDKLS
TCKTVAVKMLKGGATTNERKALMSELKILIHIGHHLNVVNLLGACTKPGGPLMMIVEFCK
YGNLSNYLRSRRGDFVVCKRQEGKAVSGSGSPGCELSELMKRRLESVASTGSSASSGFIE
DKSYCDSEEEEDEPEDLYKRVLTLEDLICYSFQVAKGMEFLASRKCIHRDLAARNILLLE
NNVVKICDFGLARDVYKDPDYVRKGDARLPLKWMAPEAIFDKIYTTQSDVWSFGVLMWEI
FSLGASPYPGLQIDEEFCCRLKDGTRMRAPEYSSSEIYQTMLDCWLGEPLQRPTFTELVE
HLGDLLQASVQQEGKHYIPINTALLANIGDPSITLTEEDTSTQPASNRHSGSTWNTKIRP
ASVKTFDEVTMDNVTNENHGXXXXXXXXXXXSDDMNTLNRLESLVGRPVSIMALAVQMKP
VSKSKECVLTDGEREKYQSAVPPLDFSRLDDSGLEPALECHSPPPDYNYVVRYSTPPV
Download sequence
Identical sequences ENSGMOP00000004042 ENSGMOP00000004042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]