SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004047 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004047
Domain Number 1 Region: 637-711
Classification Level Classification E-value
Superfamily EF-hand 0.000000471
Family Calmodulin-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004047   Gene: ENSGMOG00000003799   Transcript: ENSGMOT00000004170
Sequence length 713
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1065:42208:61039:-1 gene:ENSGMOG00000003799 transcript:ENSGMOT00000004170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YQDTAVDLFLCVTANLQDGAGFSSTALRLLSPXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXF
LRTCADVFRLLPFLVFIIVPFMEFLLPVALKLFPNMLPSTFETKSKKEERLKKELRVKLE
MAKFLQDTVEEIALRNKASKSSVTKEFSTFFQMIRDSGERPSNEQILRFSKLFEDELTLD
NLTRPQLVALCRLLELQSIGTNNFLRFQLIMKLRTIRADDKLIAEEGVESLNVTEVQAAC
RVRGMRSLGVTEDRLREQLSQWLELHLKQQIPTSLLLLSRAMFLPDTLSPADQLKTTLQT
LPEMVTREAELMAAEMELSKVDHKSKVESTLQEEAVIRQDNKEREMERLADAAQRTIRXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEEITKE
EIDLLSDACSKLKEQKRLLTLEKEELEELKDDVQEYNEDLEEMKKELSKTGQEEVVEESK
ASKRLAKRVDRMILRVGKIIGELEKDKEVLESWTGSWSRPPLGENLVSIDELIAVMKQIQ
NIPEHKLQSIAAALDDNKDGKIDIDDVIKVVELIDKEDIDISTNQVADIMVML
Download sequence
Identical sequences ENSGMOP00000004047 ENSGMOP00000004047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]