SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004098 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004098
Domain Number 1 Region: 4-131
Classification Level Classification E-value
Superfamily Histone-fold 9.47e-45
Family Nucleosome core histones 0.00000409
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004098   Gene: ENSGMOG00000003880   Transcript: ENSGMOT00000004224
Sequence length 132
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1589:5113:49768:-1 gene:ENSGMOG00000003880 transcript:ENSGMOT00000004224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAHRVGAGAPVYLAAVLEYLT
VLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQA
VLLPKKTEKPAK
Download sequence
Identical sequences ENSGMOP00000004098 ENSGMOP00000010648 ENSGMOP00000004098 ENSGMOP00000010648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]