SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004206 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004206
Domain Number 1 Region: 488-857
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 8.5e-132
Family Hect, E3 ligase catalytic domain 0.00000000000545
Further Details:      
 
Domain Number 2 Region: 391-432
Classification Level Classification E-value
Superfamily WW domain 0.00000000000000801
Family WW domain 0.00069
Further Details:      
 
Domain Number 3 Region: 323-356
Classification Level Classification E-value
Superfamily WW domain 0.000000000000608
Family WW domain 0.0013
Further Details:      
 
Domain Number 4 Region: 18-143
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000002
Family PLC-like (P variant) 0.001
Further Details:      
 
Domain Number 5 Region: 295-324
Classification Level Classification E-value
Superfamily WW domain 0.00000000816
Family WW domain 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000004206
Domain Number - Region: 442-468
Classification Level Classification E-value
Superfamily WW domain 0.000283
Family WW domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004206   Gene: ENSGMOG00000003920   Transcript: ENSGMOT00000004335
Sequence length 863
Comment pep:novel genescaffold:gadMor1:GeneScaffold_497:164289:200486:-1 gene:ENSGMOG00000003920 transcript:ENSGMOT00000004335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAASVTRPGSAQTTEKSQLTLKVVSAKPQSPKLPSRSSRLSSFVEVTADGLSSETKKTG
KRSGHLELQWNEDLTLNVTPQSRLDLKLWSCHTLRKELLGSATIDLLDTLRTHHGKMENV
QLSLVLQTENKGSVVAGGELTVCLDGLVVDLGSLPNGSMATDSESRLFXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXTGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWE
QRVLPHGRVYYVDHNTKTTTWERPLPPGWEKRVDQRGRFYYVDHNTRTTTWQRPTAESVR
NYEQWQSQRNQLQGAMQQFSQRFLYQSTAAPVENDPQGTLPTGWEKRQDNGRVYYVNHNT
RTTQWEDPRTQGMIRAPSAPREMKYTAEGVPYFVDHNSRATSFKDPRPGFEAGSRQGGSP
GAYDRSFKWKYHQFRFLCHSNALPSHVKISVSRQTLFEDSFQQIMNVKAYDLRRRLYIIM
RGEEGLDYGGIARWEWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASSINPDHLTYFRF
IGRFIAMALYHGKFIDTGFTLPFYKRMLNKKPTLKDLESIDPEFYNSIMWVKENSLEECG
VELYFAQDMEILGKVSTHQLKDDGENELVTEENKEEYISLLTDWRFTRGVDEQTKAFLDG
FNEVVPLEWLRYFDEKELELMLCGMQEIDLADWQKNTIYRHYTKNSKQIHWFWQVVKEMD
NEKRIRLLQFVTGTCRLPVGGFTELIGSNGPQKFCIDKVGKDTWLPRSHTCFNRLDLPPY
RSLEQLREKLLFAIEETEGFGQE
Download sequence
Identical sequences ENSGMOP00000004206 ENSGMOP00000004206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]