SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004265 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004265
Domain Number 1 Region: 393-501
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-28
Family Second domain of FERM 0.00022
Further Details:      
 
Domain Number 2 Region: 502-611
Classification Level Classification E-value
Superfamily PH domain-like 1.62e-24
Family Third domain of FERM 0.0049
Further Details:      
 
Domain Number 3 Region: 722-824
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-24
Family PDZ domain 0.0099
Further Details:      
 
Domain Number 4 Region: 907-1009
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-20
Family PDZ domain 0.00053
Further Details:      
 
Domain Number 5 Region: 305-393
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.54e-19
Family First domain of FERM 0.015
Further Details:      
 
Domain Number 6 Region: 1045-1141
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000333
Family PDZ domain 0.031
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000004265
Domain Number - Region: 7-149
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000235
Family Protein kinases, catalytic subunit 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004265   Gene: ENSGMOG00000003974   Transcript: ENSGMOT00000004396
Sequence length 1149
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4588:297127:315688:1 gene:ENSGMOG00000003974 transcript:ENSGMOT00000004396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTFVTLAEVLEARGGPLVEEEVWSLLMGTAESLVDVSYRGNNSIYNIISPSSLLLSAT
GTLAFKNSALSDEVSTFTAPEMLQGRASSAKPAIERMLVYSLGMTLYWSVDYHLPQNQPV
QLSDNLNGLLLSMCEDLVHRRLNLNSILEACESQNKTTLLPPPSKVIRQLVDEVLHESIS
ATAAAKGEDTQQTLTQSQVMRGRQESTPATVEAQTQELPHPSVPLFFRQVPSWRPSPGQH
QQLALASVRTHSPSITFSESSLSLNQRKAKALGPEFLRMTDDQQQTVLELPGSIVSKKGR
SCASQREVNVTLPSAQCVVVRCDLKSRARDVFDMVVAHANLVEHFYFGLAFLDDDEYFFL
DHEIKISKVAPEYWKKMPLSTFALFLRVKFYVDDISFVLHRLTRHQYFLQMRKDILEDRL
HCNEETGMFLAALALQAEFGDYMPEVQSKSYYQPEHYVSKRMLETMALPTLKEELPRLHA
RHAQMLHEEAEIEYLKITQQLPEYGVMFYRVGREKRPVVGELVLGICAKGIVLYETKNHV
RTVTRRFLWRETDSISTGRRKLTLECGGPSGKKHSFVTESSKIAQYLLNLCSAQHKFHSE
MASRQLNHSAVQEESMEKYADAVCRLRNSELKRISCSEGMLNMVGLAAGQQDALSKSCDN
LTAKLEARLRQQRELRREMSREMVMSGSNKELSEAEDPREARERQGWGWMSSVSLQKQDS
SSSIRFDTPTRTPPEREIICVTIKKDPKLGFGFVIVGEDNTGRLDLGIFIASIVPEGPAD
KDGRIRPGGRLISLNKTSLEGVTFSDAAAILQSSPDEVELIVSQPKLINHFSSVSLKDSK
SFLTQSNLGLALEKGFGSQTTLNSTEFRPAMEELEEALALANMAAPKLGRRLHVPVVRIL
DAQDPCSRSPSICSLKMGEQLIVELKKNDGSLGISVAGGINTNVRFGGIYIKTLVSGGAA
XXXXXXXXXDRLLEVDGFNLRGVTHRQAVECLKRTGEVVSLLLEREPMVVLDTRSESPCP
PLAHSQSLAMKIDVPMETTLSGKPKDYSFVTDENSHEVVLKKSPCGLGFSFFITQPPGGV
SLVRIKRLFPGQPAHDSGLLREGDVLLAVXXXXXXXXXXXRVLFLLRGAPSDVQLLICRP
TAGELTEMD
Download sequence
Identical sequences ENSGMOP00000004265 ENSGMOP00000004265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]