SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004268 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004268
Domain Number 1 Region: 17-108
Classification Level Classification E-value
Superfamily EF-hand 3.77e-22
Family Parvalbumin 0.0000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004268   Gene: ENSGMOG00000003990   Transcript: ENSGMOT00000004399
Sequence length 110
Comment pep:known genescaffold:gadMor1:GeneScaffold_1790:310079:313259:1 gene:ENSGMOG00000003990 transcript:ENSGMOT00000004399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMAFAGILADADCAAAVKACEAAESFSYKAFFAKCGLSGKSADDIKKAFFVIDQDKSGFI
EEDELKLFLQVFKAGARALTDAETKAFLKAGDSDGDGAIGVDEWAVLVKA
Download sequence
Identical sequences ENSGMOP00000004268 ENSGMOP00000004268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]