SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004323 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004323
Domain Number 1 Region: 387-679
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.17e-97
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000011
Further Details:      
 
Domain Number 2 Region: 99-190
Classification Level Classification E-value
Superfamily PDZ domain-like 8.81e-18
Family PDZ domain 0.026
Further Details:      
 
Domain Number 3 Region: 3-84
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000999
Family PDZ domain 0.0054
Further Details:      
 
Domain Number 4 Region: 202-257
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000828
Family Interleukin 16 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004323   Gene: ENSGMOG00000004051   Transcript: ENSGMOT00000004456
Sequence length 695
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4588:317673:330885:1 gene:ENSGMOG00000004051 transcript:ENSGMOT00000004456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EFELSVELTKSRNGSFGFTIARSKLDNSYYVQDILDNPARADGRLRSGDRLVTVNGHDVT
RVADELAMTILRSSPRHLSMTLGRAVSNLVAPPSCDSLPDIVLHKTPSGQLGIKLTGGIG
SRWQGIYCLEVVPGSPASEEGSVQPNDKIVYICGRCTLGMSLEDAVKACEIAPRKVKLKV
IREDHPVTPKAKWNVQKEPFTGLLFLWSAGPAGRLPSDVDFTKPENSGLGFALIGGANGS
VLRVKEICTGGLAEQDGERRHRLGAEPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXAVPSLPHPSPRKQFVTTLLEQHPKCIRINQSDGWSSD
EEDEDAVQLNRQEMTSVPTGPPIVSEGELASLALITPSKNSRYYGSRVKALIQILQNQLD
QEELVKEFMALEHLKPSDNCLVGKAPENRDKNRYRDILPYDKTRVALGEARDYINASYIR
MAVGPEEFQYISCQGPLPATARAFWQMVWENKSDVVAMMTQEVERGRIKCHKYWPETPSQ
ALEEGRFQLHLVNQQSLDYFHIKVIRMEETQTGATHVVRHLKFTHWPDHGVPHSSEQLVR
FIRYLRAVHHSGPLTVHCSAGIGRTGVLICTDVILSLIENDLPINVGDIVREMRLQRYGM
IQTKEQYLFCYKVWLDVLQGILRLHGNQWQPDAPL
Download sequence
Identical sequences ENSGMOP00000004323 ENSGMOP00000004323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]