SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004329 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004329
Domain Number 1 Region: 68-231
Classification Level Classification E-value
Superfamily EF-hand 1.72e-45
Family Penta-EF-hand proteins 0.000000956
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000004329
Domain Number - Region: 11-64
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00259
Family beta-sandwich domain of Sec23/24 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004329   Gene: ENSGMOG00000004075   Transcript: ENSGMOT00000004462
Sequence length 232
Comment pep:novel genescaffold:gadMor1:GeneScaffold_829:587950:595986:1 gene:ENSGMOG00000004075 transcript:ENSGMOT00000004462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYPGYGGSQYGAPMPGMPHQGMPHHQGHPMPGPMGQMGGQPQGAYAQYGAQYQGAAYGA
PPPATNDPMYGYFTAIAGQDGEIDADELQRCLTQSGISGTYTPFSLETCKIMIAMLDRDH
TGKMGFNEFKDLFTALNGWKQNFMMFDRDRSGTVEPQEMSQAVSAMGYRVSPQALNVIIR
RYSKNGRVYFDDYVACCVKLRTLTDVFRRRDTMQQGAVSFQYDDFILCTMSI
Download sequence
Identical sequences ENSGMOP00000004329 ENSGMOP00000004329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]