SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004338 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004338
Domain Number 1 Region: 327-490
Classification Level Classification E-value
Superfamily EF-hand 1.57e-34
Family Calmodulin-like 0.0044
Further Details:      
 
Domain Number 2 Region: 56-303
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 1.27e-17
Family Glycerol-3-phosphate (1)-acyltransferase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004338   Gene: ENSGMOG00000004073   Transcript: ENSGMOT00000004471
Sequence length 529
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3454:283069:294775:-1 gene:ENSGMOG00000004073 transcript:ENSGMOT00000004471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPPPQRIFALPRQQSLLLPAVINPFVQETKLSKADIIKCVLLGIFLVPIRGILLSLVLMI
TWPVAVITTFKHPLKGSVEPMTGWRRFMCRRVMAPLGRAYYFAMGFRVVVKGKQVSSREA
PILAVAPHSTFFDGIVCIVAGLPSTVSRVENLATPIFGRCVRCLQPVLVSRERTDSRKNT
IREIEKRAKSEGVWPQVLIFPEGTCTNRSCLITFKLGAFIPGVPVQPVIMRYPNKLDTVT
WTWQGFSSKTLLLLTLCQLYTTVEIEFLPPQIPTEEEKKSAPLFASTVRRVMAEALGVPV
TDHTYEDCRLMISAGELTLPMEAGLVEFTKISRKLNLKWENVQKELEGFAVKASSCQGGR
ISIQEFARFLKLPISPALEELFALFDRDGDGTIDFREYVIGVTILCRPANTEDVLRMAFK
LFDTDEDQRITRLEFSALLRSALGVSDLNMTKLFKEIDADASGFITFAEFEAFALTHPEY
AKLFTTYLELQRYQALPGTRGPSGLEEGLLQGPGPADQGSDSASDKKDD
Download sequence
Identical sequences ENSGMOP00000004338 ENSGMOP00000004338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]