SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004366 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004366
Domain Number 1 Region: 197-334
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-42
Family Third domain of FERM 0.000000306
Further Details:      
 
Domain Number 2 Region: 86-196
Classification Level Classification E-value
Superfamily Second domain of FERM 9.94e-34
Family Second domain of FERM 0.00000234
Further Details:      
 
Domain Number 3 Region: 491-578
Classification Level Classification E-value
Superfamily Moesin tail domain 4.32e-31
Family Moesin tail domain 0.0000258
Further Details:      
 
Domain Number 4 Region: 2-84
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.55e-22
Family First domain of FERM 0.0000207
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000004366
Domain Number - Region: 340-428
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0196
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004366   Gene: ENSGMOG00000004115   Transcript: ENSGMOT00000004499
Sequence length 578
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3776:14136:21641:-1 gene:ENSGMOG00000004115 transcript:ENSGMOT00000004499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QINVRVTTMDAELEFAILHSTTGKQLFDQIVKTIGLRETWFFGLQFQDTKGFSTWLKLNK
RVTAQDVKRENPLLIKFRGKFYPEDVADELIQETTQRLFFLQVKESILNDDIYCPPETAV
LLASYAVQTKHGDYRKDYHIPGYLAKEKLLPQRWVLEQHKLNNSQWEERIQVWHQEHKGM
LREDGMVEYLKIAQDLEMYGVNYFNIKNKKGSDLWLGVDALGLNIYDQTDKMTPKIGFPW
SEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHDLYMRRRKPDTIEV
QQMKAQAKEEKNKRQMERALLAKEKKKRENAEKETEKIARETMELMERLRQIEEQTKRAQ
DELEEQTRRALELEKERKIAQEEAERLDKDRKEAVEAKAALMNQSEQQLKNQENLATELA
ELTSKISKLEDAKKKKDEEAKRWQTRAMAVEGDLERTEVDLKSKLMGVHIPASVHSHMHE
HDETDESSAEASAELTSPDMVRDRSEEERVTEAQKNKMLRKNLKFLSTELACAVDESKKT
PNDLIHAANVKAGRDKYKTLRQIRQGNTKQRIDEFESM
Download sequence
Identical sequences ENSGMOP00000004366 ENSGMOP00000004366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]