SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004416 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004416
Domain Number 1 Region: 38-252
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.8e-59
Family DBL homology domain (DH-domain) 0.0000000041
Further Details:      
 
Domain Number 2 Region: 237-391
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-46
Family Pleckstrin-homology domain (PH domain) 0.000000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004416   Gene: ENSGMOG00000004165   Transcript: ENSGMOT00000004551
Sequence length 458
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3776:48030:63224:-1 gene:ENSGMOG00000004165 transcript:ENSGMOT00000004551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASRQLWVNQEDGGAEPVEGTSEVQNGHLDPTNDCLCLGSPLQNRDQMRANVINEIMSTER
HYIKHLKDICEGYLRQCRKRVDMFNDDQLRVIFGNIEDIYRFQMGFVRDLEKQYNTEDPH
LSEIGPCFLEHQDGFWIYSEYCNNHLDACMELSKLMRDGRYQHFFEACRLLQQMIDIAID
GFLLTPVQKICKYPLQLAELLKYTAQEHSDYRYVAAALAVMRNVTQQINERKRRLENIDK
IAQWQASVLDWEGDDILDRSSELIYTGELSWIYQPYGRSQQRVFFLFDHQLVLCKKDLIR
RDILYYKGRIDMDRYEVRDATDGRDDDFNVSVKNAFKLCNKDSEEIHIFLAKKLEEKIRW
LRAFHEERKMVQEDEKIGFEISEYQKRQAAMTVRKVTKQKGVNRCTPPSYPPPQDPLSAG
HYEVTEDMAQGEVFELSQSKRGQAPFWQNFSRLAPFKK
Download sequence
Identical sequences ENSGMOP00000004416 ENSGMOP00000004416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]