SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004546 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004546
Domain Number 1 Region: 315-479,857-1030
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.79e-109
Family Mammalian PLC 0.0000092
Further Details:      
 
Domain Number 2 Region: 631-727,787-812
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-28
Family SH2 domain 0.0000423
Further Details:      
 
Domain Number 3 Region: 517-627
Classification Level Classification E-value
Superfamily SH2 domain 8.89e-24
Family SH2 domain 0.00075
Further Details:      
 
Domain Number 4 Region: 1047-1167
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.29e-22
Family PLC-like (P variant) 0.0033
Further Details:      
 
Domain Number 5 Region: 755-830
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-16
Family SH3-domain 0.00029
Further Details:      
 
Domain Number 6 Region: 162-310
Classification Level Classification E-value
Superfamily EF-hand 0.000000146
Family Calmodulin-like 0.061
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000004546
Domain Number - Region: 468-509
Classification Level Classification E-value
Superfamily PH domain-like 0.000727
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004546   Gene: ENSGMOG00000004227   Transcript: ENSGMOT00000004682
Sequence length 1245
Comment pep:novel genescaffold:gadMor1:GeneScaffold_469:124001:142802:1 gene:ENSGMOG00000004227 transcript:ENSGMOT00000004682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDMARPAFGQGELTEYKRSLMKRDLEMGMVMSVFRQRVERLTVQVVTETRQVAWTRTADK
TDGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDTVED
AEKWLTGLELLRQETLVAPTPAIIESWLRKQMYSINHTKKNSLTLKELKALLPQINYKAS
STRVLKDKLSEVGAKKEHLDFAQFHKLYNLLMFEQKDQILEEFKKESCAFIMGNTDRPDA
STVLLHDFQRFLLYQQKEPWANNLNLVKELMTTFIDDTMRKTNEPEFNVSEFLNFLFSKE
NSIWDEKQSEINTADMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYVRCLRLGCRCIEL
DCWEGPGEPIIYHGWTRTTKIKFEDVVKAINEHAFVTSQYPVILSIEQHCPVEQQKQMAR
IFTDVCKDKLLTEPVEHMAEQLPSPTQLMGKIILKHKKLNLEESISSKDFRKGQKQGDLD
IWDPVDQRWNKHYCVIANNKLYYAEEYESEEGEPQEFQEQPWYHGCLRGRAAEKLLEDFC
AVSGDLDGTFLVRKSNTNLTRFTLSFRRGGRVQHCRISSRLEEGRACYFLTNSMLFPSLN
DLIQHYRANPLRCQDFELRLTDDVPQPDLHLHRSWFYSNLSRGQAEDYLLRIPRDGAFLI
RQREGVADTFAITFRGDGKVKHCRINMEEGVFLLGNSTEFDSLVELVNYFKKKPLYRKIK
LRYPVTPELVSRFSTEKDCASLYEMKTYVEPNEIEPTLPLNSVKALYAYQATRPDEHTFY
KGAIIHNVTKENDSWWKGDYGGKLQLYFPANRVEELSSNPKPAKSQEMEYNPLGELCKGI
VDISKCNIQNLANGKNQKSHVLSLQENTDDSLEFDLSADSLEELFEWYQVAWDITQREMN
KQYQRQEVAKRDVVAMEMSDLVVYCQPRSKEKDRFDSYTYKEVRSFVENKTPGKSQTQKF
LQYNRMALSRVYPKGQRVESSNYDPHPLWAAGCHMVALNFQTADKYTQLNSALFSLNAST
GYVLQPEMMRFDTYDPNSERRQVKMNVVVRVIAARHLPKLGRSIVSPFVEVELCGHTEDN
KFKTAVFRENGLNPLWKTPAEAAALPVYDPELSFLRFVVNEEDMFSDPNFLAQATFPLRG
IRTGYRSVPLKNGYSENLELASLLIYIDIEQVGKAEEELYSSSGQLQKKPSSGSEPFLYD
SHSSQATLARQSSAEKQKESDIPFLLFVFVCYRVKEKKINNSKFY
Download sequence
Identical sequences ENSGMOP00000004546 ENSGMOP00000004546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]