SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004594 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004594
Domain Number 1 Region: 235-433
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-43
Family DBL homology domain (DH-domain) 0.0000000668
Further Details:      
 
Domain Number 2 Region: 425-548
Classification Level Classification E-value
Superfamily PH domain-like 1.7e-28
Family Pleckstrin-homology domain (PH domain) 0.0000444
Further Details:      
 
Domain Number 3 Region: 2-111
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.27e-23
Family Calponin-homology domain, CH-domain 0.00088
Further Details:      
 
Domain Number 4 Region: 157-217
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-23
Family SH3-domain 0.0000767
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004594   Gene: ENSGMOG00000004297   Transcript: ENSGMOT00000004732
Sequence length 791
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3069:67861:137885:1 gene:ENSGMOG00000004297 transcript:ENSGMOT00000004732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSAEQTVTWLITLGVLDSPKKRISDPESFLQSSLRDGVVLCRLLERLRPGTVLGKVFSD
PRAESECQSNISEFLQVCSVFSVEPFEASDLLQGQDISRVLTCLVALNKATEGVPAPPIS
SSRIKSFESLNTQCQSSKLLQPQYRSLDMSEGSGCGQTLVKARFPFQQTNEDELSFSKGD
LITVLRQEEGGWWEGALGGRTGWFPNNYVREVKDSEKLLSPRSGTLKSPPKGFDTTIVNK
TYYNVVLQNILETESEYSRELQSLLVSYLRSLHPTEKLCSPDIALIQGNLEEISTFQQML
VQSLEERTKLPEAQQRVGGFFLGLMSQMKTLYMAYCSNHPSAVNVLTQHSEELGAYMESK
GACVPGILTLTTGLSKAFTRLDRYPTLLKELDRHMEDHHPDRADLHTCMTAFKLLASQCL
EVRKRKELELQILTEPIRNWEGDDIRTLGPVLHMVQTGVFTQGCLERNERYLLLFAHTLL
ILSPSPRMSGFIYQGRIPLSGMLISRMEDGDNIRNAFEISGSHCERMQVTCNSHEELQEW
LDLLTKHTHTPSAHAHTPAQPPATHTPTPHPATPSRHSESCGGGGGQYHTLPPPPPPTSF
GGGSVWGSLEPPSSPRPWSQSXXXXXXXXXXXXXXXXXXDQNKSPKNMKKLLPKRKPERK
PSEEDFTARKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSRKDVHVLFPEEEKIIVE
EMKSNGQTVVEERSLVDTVYGLRDEVQDLKQDNKRMRRTLEEEQRARKEMERVVRRVLKN
LNDPSWDETNL
Download sequence
Identical sequences ENSGMOP00000004594 ENSGMOP00000004594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]