SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004604 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004604
Domain Number 1 Region: 566-752
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.27e-52
Family DBL homology domain (DH-domain) 0.000000222
Further Details:      
 
Domain Number 2 Region: 756-891
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-35
Family Pleckstrin-homology domain (PH domain) 0.00000179
Further Details:      
 
Domain Number 3 Region: 987-1043
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000525
Family SH3-domain 0.004
Further Details:      
 
Domain Number 4 Region: 250-387
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000331
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 5 Region: 62-159
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000301
Family CRAL/TRIO domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004604   Gene: ENSGMOG00000004299   Transcript: ENSGMOT00000004742
Sequence length 1045
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3590:732095:757643:1 gene:ENSGMOG00000004299 transcript:ENSGMOT00000004742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPVQLTEVVGYIEKQVAYLSGGRGEDSSVIITLPECSAFSDIPEESLAKVLTYLTLIPRT
RQPGVKFIIILDRRLDTWGSIKTALGRIAASFPGNLHLVLVLRPTSFFQRTVTDLGFRFS
QEDFMLKMPVVMLSSVTDLLRYIDENQLTSEFGGTLDYCHSDWIVLRTAIESFAVTVKDI
AQMLQSFGTDLAETELTDEGGAIECLLKAHTDKYRNLKEAIRSVSKEGRHLLSILESSGN
EEDCHWDVRLDWDTVQRLLSQLRDMESAFDGFFEKHHLKLLQCIQLLRYEKSFQEMEKSL
QGLTSQEKELSSSAETLAQAEQALKELESLDSQAQEVMGGAQIVILHGHQLAASHHYALA
LIVQRCNELRHHCDTLSSALKAKQTRLLCTHQLLLSFGQXXXXXXXXXXXXXXXXXXXXX
XXXXXXXALRDIERFLEGAPSMLSSGPEALLQEYEAVLTPQLQSQMLKTFEKHGTVQLMI
QNRQACLRKLADKHVRPVQLVVPRPDNNAPRCKSPLFSPKHXXXXXXXXXXXXXXXXXXX
XXIEVMHDYQENRSCVSYTLDGEESPDLLKRHVLRELIETERVYVEELLSVLLGYRAEMD
NPSLWDLLPPILRSKRDILFGNMPEIYNFHSRVFLQDLEGCIDTPERVGACFLEQKENFQ
MYECFCQNKLRSEALWRQFSDCAFFQECQKKLEHKLGLDSYLLKPVQRITKYQLLLKELL
KCSTGSEDTSELQGALAAMLELLKSVNDSMHQIAITGYEGELCELGRVLMQGSFSVWISH
KKGPTRMKELARFKPMQRHLFLYERALLFCKRREEHGEGCDKTPSYSFKHCLKMSAVGIT
ENVKGDVKKFEIWYSGREEVYVIQAPTVEVKMTWLNELRRILTSQQKLLKDEAYQHSQLV
EHVPLSPLHHESSRSKQQRASVSSEDTESGRSSPDPQPHSPQPQHNRRSWPGAPHSVVIC
EGLEEWSGGQDHTHPSDTDDEVIALSPGRYRALDDCLRNGADNVSIKCGDVIHLQHVDSQ
GLWLVKNLSRRQEGVVPSSSLQLIL
Download sequence
Identical sequences ENSGMOP00000004604 ENSGMOP00000004604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]