SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004687 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004687
Domain Number 1 Region: 143-345
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.98e-49
Family DBL homology domain (DH-domain) 0.0000167
Further Details:      
 
Domain Number 2 Region: 342-465
Classification Level Classification E-value
Superfamily PH domain-like 1.7e-31
Family Pleckstrin-homology domain (PH domain) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004687   Gene: ENSGMOG00000004408   Transcript: ENSGMOT00000004827
Sequence length 533
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1722:57082:101559:-1 gene:ENSGMOG00000004408 transcript:ENSGMOT00000004827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGGRHPHHQRGHQHGCGCQRLFCKVLAKCGCCFARSYSAGGSEGSLSTSVASLPPGASA
SSAPSSPGSRRSVSTLKKWLTNPVRKLSAGATKXXXXXXXXXXXXXXXXXXXXXGPLLQD
TESTNAVPDDSSSALMDDTSSQSSEAACTEEDRRSALEKSMYVLKELTETEKHYVLDLGL
IVEGYMATLHSKGVPDDMKGKDKIVFGNIHQIFDWHKDYFLGELEKCLEEPERLAQLFER
RLQMYVVYCQNKPKSEHIVSEYIETYFEEVRQQLGHRLQINDLLIKPVQRIMKYQLLLKD
FLKYYTKAGMDTEELEKAVEVMCFVPKRCNDMMNVGRLQGFEGKITAQGKLLQQETFTVM
EQESSLLSRARERRVFLFEQMVIFSEPIDRKKGFLLPGYTFKNSIKVSCLGVEPSKDGDA
ARFVLTSRNPDGSMVRFQLQAPSADICQAWVDDVNQILESQRNFLNALQSPIEYQRRESK
SNSLGRCIRPPLSASAGLRPHSSASIDRHKLPSLQSHNASLPTLYLGSQAHGP
Download sequence
Identical sequences ENSGMOP00000004687 ENSGMOP00000004687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]