SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004703 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004703
Domain Number 1 Region: 139-334
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.16e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.000000121
Further Details:      
 
Domain Number 2 Region: 71-133
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.89e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000968
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004703   Gene: ENSGMOG00000004434   Transcript: ENSGMOT00000004843
Sequence length 334
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1009:572692:583666:1 gene:ENSGMOG00000004434 transcript:ENSGMOT00000004843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSREAYEGQKGDKSLVQKGKREANQEEILAAALGMRMGPQKPPATLWQPLKLFAYSQLT
SLVRRATLKENAAGPKYDKVHNFKVHTFRGPHWCEHCANFMWGLVAQGVKCADCGINVHK
QCSAAVPNDCKPNLKHVRKVYSCDLTTLVKAHNTTRPMVVDMCIREIESRGLKSEGLYRI
SGFSDSVEEVKMAFDKDGEKTDISVDAYEDINIITGALKLYLRDLPVPIISYDAYPRFIE
AAKIDEPEKRLEALREAIALLAPSHSETLQYLMVHLKRVALHEEHNLMNVENLAIIFGPT
LMQAPDMDAMKALNDIRYQRQVVELLIKKEDVLF
Download sequence
Identical sequences ENSGMOP00000004703 ENSGMOP00000004703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]