SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004736 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004736
Domain Number 1 Region: 399-576
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-47
Family DBL homology domain (DH-domain) 0.0000411
Further Details:      
 
Domain Number 2 Region: 586-698
Classification Level Classification E-value
Superfamily PH domain-like 5.19e-26
Family Pleckstrin-homology domain (PH domain) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004736   Gene: ENSGMOG00000004436   Transcript: ENSGMOT00000004876
Sequence length 738
Comment pep:novel genescaffold:gadMor1:GeneScaffold_467:145:21788:-1 gene:ENSGMOG00000004436 transcript:ENSGMOT00000004876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WVCVLQVVTINGLQRFVDVSQLPVEMNGSFCYCHQSWLCFRSHVEKLTRQCEDVISLLQK
NIQCLEYKPLPLSKEEAVGGVECLYQQVDELIHGLVKLCNAGQERDFILAFSSLEQGFSQ
VRGWIQQVGYPTLRPLGELEGSSLEQINKKHQDFKQFRLTADRVCRQGQGLLQRLNQWDD
LSSSLLDPYRVKVHSLRSELWEFSERVEATGARLNKTLSLYKFCNKAYDSALQGLRYLVT
IPMHDCTEAAKCQAVIERLESYRSQHPPIPEHKFMEMRVEAEELTEGGGLQLWTSSRKWY
QETNQEFHSKMDAALRTRQKAWCSPDPSTLHEMPAGPYDHAPCPTPAWPPRRGNTGVHIK
GLEISHSQPRPLSAVTSTQVQPLPLTSTPTGPASQPHPKQQHIVDEMVSTEREYVRSLRY
VTQQYFPEMERPDLPQELRGQRCVVFGNLENILDFHSQFFLKELEACWRHPLRVAQCFLR
YKDQFGLYALYSKNKPKSDALLASHGNSFFRVKQLSLGDRLDLASYLLKPIQRMSKYALL
LKDLLKQLSPAEEEGFNALQAANHMISFQLRHGNDLLAMDAIRLCDVNLKEQGALLRQDR
FTVLSGRKKSLRHVFLFEELLLFSKPRAVEGGVDLLYKHSFKTADLGLTASAGDGGLQFE
VWFRKRWSRSHALTLQAVTKQAWTDDITHLLWSQANRNKEVRMKEMVCMGVGSKPFLDIK
ETDAAISDRSVNFVMKKR
Download sequence
Identical sequences ENSGMOP00000004736 ENSGMOP00000004736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]