SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004809 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004809
Domain Number 1 Region: 213-413
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-47
Family DBL homology domain (DH-domain) 0.000000136
Further Details:      
 
Domain Number 2 Region: 406-531
Classification Level Classification E-value
Superfamily PH domain-like 1.85e-28
Family Pleckstrin-homology domain (PH domain) 0.0000304
Further Details:      
 
Domain Number 3 Region: 151-215
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-23
Family SH3-domain 0.000074
Further Details:      
 
Domain Number 4 Region: 1-113
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.23e-21
Family Calponin-homology domain, CH-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004809   Gene: ENSGMOG00000004513   Transcript: ENSGMOT00000004950
Sequence length 744
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3590:1079064:1104180:1 gene:ENSGMOG00000004513 transcript:ENSGMOT00000004950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPEEQTVTWLISLGVLSSPKKNIADPEDFLKTSLKDGVVVCKLIERVVPGFTAKYCQDP
RTEADCISNIREFLRGCTSLKVEGFEAECLYTGEQFGKVLTTLLAVNFATQDCATERSCP
AGLHCFSHNLSSVKSKGSLREMGENGGGGQAMVKARFNFKQNNEDELSFNKGDLIHVSRQ
EDGGWWEGSLSGRTGWFPSNYVREVKPCEKPGSPKGTPLTKNYYSVVVQDILEHEREFVK
ELQTVLGCYLRPLQASDKLSSADSASLCGNLEEILTFQQGLCVALEECTKVQESLQRVAG
CYLNLLPQIRHLYLAYCSSHPSAVCVLTDHSEELDKFMESQGASGPGILTLTTSLSRPFM
RLDKYPTLLQELERHVEDAHPDYGDIVKAMAAFKNLVTQCQDLRKRKNLELQILSEPVRG
WEGDSMKSLGSVAYMSTVHTQSGTSEEKEECYLMLFPNMLVMLSASPRMSGFIYQSRLPL
TGATVTRQPEDPETAHYAFDITGSVMERLTVFCSTLQDYQEWLEHLQPYIKGGSPVGTIQ
KGSFSVGSRSPLEPPKLSKPWSLSCLRPAPPLKPSAALGYKERMSYIMKDSSKSPRPIKK
FLPGNRKKDRKPSEDDSLIRKSTAALEEDAQILKVIEAYCTGAGLHQSASGGELLRKECG
PQVLLPEEEKIIVEEMKSNGQTVIEEKSLVDAVYALKDEVHELKKEHNRMRQFLEDEQKS
RKDLERVVRKLSKQKNDMAWDDAN
Download sequence
Identical sequences ENSGMOP00000004809 ENSGMOP00000004809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]