SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004855 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004855
Domain Number 1 Region: 59-280
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 1.31e-20
Family Glycerol-3-phosphate (1)-acyltransferase 0.042
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000004855
Domain Number - Region: 373-462
Classification Level Classification E-value
Superfamily EF-hand 0.00128
Family Calmodulin-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004855   Gene: ENSGMOG00000004565   Transcript: ENSGMOT00000004996
Sequence length 501
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3835:48859:61630:1 gene:ENSGMOG00000004565 transcript:ENSGMOT00000004996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTEYPHPFIHRVRLPTAHRIKGIILGSVLFPLRLVVVVLLFLLMWPIAMLRTAGLSEEEL
SRPIRGWRCWLLHAMMLSINRVMFFTLGFVWIEVKGRRADVKEAPALVVAPHSSFLDMVI
LMPTQLATVVSRSENVNLPVIGALLGFNQSVVVSRKDPESRRKAVTQIKERLTSNGYWPQ
MLIFPEGTTTNGTVLMKFKPGAFLAGGPVQPVLLSYPNKLDTMRWTYKGTTWVEALWHTM
SQFYTRVTVEYLPVYTPSQEEKDDPNLYANNVQKLMALGLPATDYVMEGRVPVRKLGGLS
LPVEPPAKAALSLLRRDGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXVFQDNTVDLRHLYLSLSTASGFTAFKSILHVAFNMFDPECRGHLPAEALS
GLMGALLGAAQRDTAQLYAAASRDDQLTEEDLLRVLTTHPTYQVVVNQYLKPEEAANGKA
VNNNRNMSNGNTTPSSNKKTD
Download sequence
Identical sequences ENSGMOP00000004855 ENSGMOP00000004855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]