SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004901 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004901
Domain Number 1 Region: 198-309
Classification Level Classification E-value
Superfamily SH2 domain 5.52e-31
Family SH2 domain 0.00000239
Further Details:      
 
Domain Number 2 Region: 5-118
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000115
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004901   Gene: ENSGMOG00000004480   Transcript: ENSGMOT00000005043
Sequence length 313
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1396:952909:957074:-1 gene:ENSGMOG00000004480 transcript:ENSGMOT00000005043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNLLAASSYPEIQGHLYVKEVGRKSWKKLYMFLRRSGLYCSTKGTSKEPRHLQLLADLED
SNIFTVVPAKKQHATPTEYEFCIKANKGRAELKELRILCAEDEQSRTCWMTAFRLFKYGI
ILYQNYKIPQQRKTLLSHFSAPVRSVSENSLVAMDFSGRIGRVIKNPLEAQSAAMEEGHA
WRKRSQRLNVLGCHSPLHHSSLSSVIHVAQLWFHGRITREESHRIIHQQGQVDGLFLLRV
SQSNPKAFVLTLCHHQKIKHFQILPCEEDGQIFFSLDDGSTKFTDLIQLVEFYQLNKGVL
PCKLRHPCTFVAL
Download sequence
Identical sequences ENSGMOP00000004901 ENSGMOP00000004901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]