SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004921 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004921
Domain Number 1 Region: 45-120
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000768
Family C1 set domains (antibody constant domain-like) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004921   Gene: ENSGMOG00000004652   Transcript: ENSGMOT00000005064
Sequence length 134
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2797:10943:13064:-1 gene:ENSGMOG00000004652 transcript:ENSGMOT00000005064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFNVTRADEGNYIFAFPLERKEYTIQLLIGVVSSVTISLEECPDCSGLVLRCESVGWYPR
PQLSWWTDGGLPLPAVTMNTTRDPTDGLYTISSTVVVERGQGARNYSCRVHQEWFNQNRE
AEIAIQGTSRQVMG
Download sequence
Identical sequences ENSGMOP00000004921 ENSGMOP00000004921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]