SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004927 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004927
Domain Number 1 Region: 221-369
Classification Level Classification E-value
Superfamily PH domain-like 1.81e-23
Family Third domain of FERM 0.0051
Further Details:      
 
Domain Number 2 Region: 114-220
Classification Level Classification E-value
Superfamily Second domain of FERM 7.07e-21
Family Second domain of FERM 0.0052
Further Details:      
 
Domain Number 3 Region: 11-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000207
Family First domain of FERM 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004927   Gene: ENSGMOG00000004632   Transcript: ENSGMOT00000005069
Sequence length 494
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1260:185839:195947:-1 gene:ENSGMOG00000004632 transcript:ENSGMOT00000005069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DAMSVLAKPERTICVLLPNKEQLDVPMGLKSTGLDVFNHVAALLGIKELHFFGLTVVKDN
EHIFLDMEEKLTKYFPKESKPDSPKVGLPKRPLPLVLFLKVQYYVENGRLICPSERKARH
LYYSDLRERVLRSECRQQEEVYFQLAGYALQADLGDHPPLEEVEQGAGPRFQPKDFFPPW
IVAKRGVHYLLCHGPKVHRELSGMSARDAILLFIKESCRLEDVPVTYYRLQKDKKEDRGT
ALLGLTLRGMQVYQEMNNLRQLLYDFPWCNVGRLTFLGKRFEIQPDGLPSARKLVYYTGS
PFRSRHLLLHLSSCHRLYLSLQPALKHLRQLEDTEDQKRYRESYISDDLDTDPQGCCCSE
GSPRLSRQSTCSSGIEADARHHGNVSMEMASVDRRLRRRLGAGSGGGXXXXXXXXXXXXX
XXXXXXXXXXETLVDEHVDMFHLADLLQGISVDFVLQSRAPVCVDRQSQSLDDVRLFPPP
ALLLPDSSLSYTFG
Download sequence
Identical sequences ENSGMOP00000004927 ENSGMOP00000004927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]