SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004932 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004932
Domain Number 1 Region: 1-226
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.96e-72
Family Calponin-homology domain, CH-domain 0.000000998
Further Details:      
 
Domain Number 2 Region: 3022-3118
Classification Level Classification E-value
Superfamily EF-hand 1.46e-36
Family EF-hand modules in multidomain proteins 0.0000152
Further Details:      
 
Domain Number 3 Region: 2931-3021
Classification Level Classification E-value
Superfamily EF-hand 2.04e-23
Family EF-hand modules in multidomain proteins 0.00012
Further Details:      
 
Domain Number 4 Region: 3098-3186
Classification Level Classification E-value
Superfamily RING/U-box 1.77e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 5 Region: 296-403
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-20
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 478-615
Classification Level Classification E-value
Superfamily Spectrin repeat 1.14e-19
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 7 Region: 2333-2491
Classification Level Classification E-value
Superfamily Spectrin repeat 3.87e-17
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 8 Region: 2568-2685
Classification Level Classification E-value
Superfamily Spectrin repeat 6.34e-16
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number 9 Region: 409-512
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-16
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 10 Region: 1428-1580
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000044
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 11 Region: 1112-1268
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000653
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 12 Region: 2710-2849
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000981
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 13 Region: 1871-2026
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000192
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 14 Region: 1544-1681
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000102
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 15 Region: 1027-1130
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000288
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 16 Region: 924-1010
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000101
Family Spectrin repeat 0.012
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000004932
Domain Number - Region: 1737-1792,1820-1916
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00011
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number - Region: 1240-1330
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000158
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number - Region: 2856-2884
Classification Level Classification E-value
Superfamily WW domain 0.00111
Family WW domain 0.00091
Further Details:      
 
Domain Number - Region: 1353-1443
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0054
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004932   Gene: ENSGMOG00000004537   Transcript: ENSGMOT00000005075
Sequence length 3462
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1949:57055:250063:-1 gene:ENSGMOG00000004537 transcript:ENSGMOT00000005075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEHDSVQKKTFTKWLNAQFSKAGKTPIKDMFSDLRDGRKLLDLLEGLTGTALTKERGSTR
VHALNNVNKVLQVLHQSNVDLVNIGGTDIVDGNRKLTLGLIWSIILHWQVKDIMKDIMSN
LQQTNSEKILLSWVRQCSAARADVNVLNFTTSWADGLAFNAILHRFRPNVFSWEKVVRMS
PVERLDHAFTVAKDQLAVDRLLDPEADVAVQLPDKKSIIMYVTSLFAVLPHDVTMEAIRE
VETLPRRYKSEDGPPAGLSPQXXXXXXXXXXXXXXXXXXXXDEEEEEEGILQEVDLDSYQ
ATLEEVLTWLLSAEDTLHMQDEVSDDVEEVKDQFHTHEAFMMELTAHQSSVGNVLQAGNQ
LIAQGNLAVEEEDEIREQMTLLNSRWESLRVASMDRQARLHEVLMDLQQQQLQQLSDWLT
QTEDRIKKMESEPVAGDVDGYKEQIELHKELQNDLEAEQVKVNSLTHMVVVVDENSGESA
TAALEEQLQSLGERWAAVCRWTEERWHKLQEVLLVWQQLLEDQSFFSAWLTEKEQALGDV
QTSSFKDHSEMNANVRRLASLKEDMELKRRTLDQLSEAGQDVESLLRSPAAGATIQGTTE
DLTLRWDSLVQTLEDCSFQVMEAVASSGGTEVEGQYVVDTVATSFVDQDSAQPAKKRMME
TDVEDRLELEGNLSALLSWMTTWTSSAQTLGCVHTSAPGDPAELHGDMKSLELQLASKEA
LIGQVTHEGRRLVDQLERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRLGQVGELGARLEQLSAEA
GSLGATPALRDTSVVVSAHHSSTLQQLRRREQDLDQDPVEALEERLGTLKDGVTDIPTTQ
SAVERAQVLCLEIEQTQKASDPAVAQRWSQLSSRARDELSTLQCILGSLKDNQVRMVEVE
RWLDAVQELMSQDATKQGEAERLQEELNQCKEYVNEMESVESSLKQMRENVCAVQGAAVP
GLTSWGQDSLDQCQARWDVFSKQLLSQQERVAERQERQVNLSKDLAEMQEWMGQVDEEFL
MRDFEYKNPEELEAALDEMKRAKEDVLQKEVRVKILKDNINALVSRTSPPAGGGGQALTS
ELDGVLANYHKLCDRFKSKSHTLEEVWSCWMELLQYLEMEQSWLGTLETNLQTTEDLPES
TEAVNRALESLEGVLRHPGDNRSQIRELGQTLIDGGILDELISEKLEAFNSRYDRLSQQA
ASRQLGLEQQLQTLQDNEQALQELQEALGQLDHTLTSYLTDRLDAFQLPQEAQSIGVEIA
AHEATVEDMKRRNVANMPPAATEGKAARSGTMLEQLQRKLREISTKYQLFQKPANFEQRM
LDCKRVLDGAQAELPVLDAPTSDPETLQAHLNGCMKLYKLLSEVKLEVETVIKTGRQIVQ
KQQTENPKSMDEQLTALKLLYNDLGAQVTEGKQDLEKALSLSQKFHKESAALQAWLTTHD
AQLQQKNSSGDMPAEIDAEVAWANGLLKETERRKAELGALAEAAGGLQTLVEGGGARLDQ
ELSGLNEGWGRVRTWTEDWLSAVLSHQNEVEIFDENLAHISTWLYQTQIHLDEAERLPSA
DRERVIKRMLEELAELRLRVDSVREQAVILMSSRGPACHDVVEPKLAELNRNFDKVSQHI
QTAQVSPSSGGPGRSEGPSEVLHLQAQLQDSLLALQRHQEPAQSLDDDKLDEEKAGVEEL
LRRGEEVLEHASDDTQREELRVLLLRLQSQYSAQRERRVLQVRQVDTSVESSSTYSYTEH
SSDHQMSPVERGSRWPLSSDYLLDINKVLLAMADSELLLNSQELSGSNYEDFSTQEDTLR
NIKDGLDQLGERVATLHERQPDAIEDASPGEVAQIGDALTQLNAEWDRLNRVYNHRKGGF
DRAVEEWRQFHCDLNDLGQWLRDTEGLMAEGTGPDGQLDLDTAALHQQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXPDGPLLQDKLEVLGQRWRAVSRQVLERRRXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXALAEEMDAQNESLAWLNKHGPPILANPI
MGPQERDMHVAKLRAINLSWSKVTRDLMDKAGEAETNMQGHAVFQDRMNRLTDWVQVTHQ
TIAARGVSPVQAQELETSMKERKRDLEDLLARSIELQRRQQLLPQEKVKVEQLASDWKAL
DVRLRESLQAPPPSSAWMQHHSMVQHQQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTKSDLEQRHPQLEDIFT
LAQNIKNKTSNLDVRTSITEKLEKVRSQWDGTQHGVEARLRQLDNMIGHSDQWEEQRLEV
ASVIGHNEGRYHSLLQHSRESLTKQLTDNKAFLQDLGRGQASVASFNDLSNQLLREYSID
DTRRIKEVADKHNAAWNGINNRASDRQAQLDCELKGLQGSLRELEAFLKWLQEAETTVNV
LADASQREELSQDPAHLKELRAQHEDIQAEIDAHNDIYRSVEGNKSKMVKALGSSEEAVF
LQHRLDDMNHRWSDLKTKSANIRAHLEASAERWSRLLGLLEELWRWICAKDEDLAKQMPI
GGDVPTLLQQQNHCTALLSELKEREHLVITTLDQARMFLADQPIEGPAEPRRNLQPKTDL
TPEEKARGVARAIRKQTGEVRERWERLTGHVGGWQSQVERALERLQELQSSMDQLDLRLT
RAEEAKEGWQPVGDLLIDSLQDHIERTTAFQEEVAPLRQDVHVVNELSADLTPLDVQLSS
TASRQLDQLNMRWKLXXVAVEERLKLLQEAHRDFGPSSQHFLSTSVELPWQRAVSQNKVP
YYIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLLELGVAQ
STFEQHKLTKNSQQLAVPDVINCLTSVYHGLEQQHKDLVNVPLCVDMCLNWLLNVYDTHS
GRSGKIRVLSMKIGLLSLSKGHLEEKYKYLFNQVSSAGDTCDQRQLGLLLHDAIQVPRQL
GEVAAFGGSNIEPSVRSCFQHVGNKVELEPRQFVDWMRMEPQSMVWLPVLHRVAAAETAK
HQAKCNICKECPIVGFRYRSLKHFNYDVCQSCFFSGRTAKGHKLNYPMVEYCTPTTSGED
MRDFTKVLKNKFRSKKYFAKHPRLGYLPVQTVLEGDNMETPVTLISMCPEQYELSQSPQL
SHDDTHSRIEQYASRLAQMERSNGSLPTDNSSATGSMDDEHALILQYCQTLGGEGGSPSS
QPQSPAQILQAVEREERGELGRVIARLEEDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXLAEAKLLRQHKGRLEARMHILEEHNKQLESQLHRLRQLLHQPEGESRVNGVSSP
SVQDRGQLNENSGAEELLDPQDSSSDLAEVMEQINNSFPACS
Download sequence
Identical sequences ENSGMOP00000004932 ENSGMOP00000004932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]