SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004933 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004933
Domain Number 1 Region: 291-392
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.00000000000000454
Family Ferredoxin reductase FAD-binding domain-like 0.0073
Further Details:      
 
Domain Number 2 Region: 398-551
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 0.0000000000000851
Family Flavohemoglobin, C-terminal domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004933   Gene: ENSGMOG00000004641   Transcript: ENSGMOT00000005076
Sequence length 565
Comment pep:novel genescaffold:gadMor1:GeneScaffold_3287:44836:72841:1 gene:ENSGMOG00000004641 transcript:ENSGMOT00000005076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNFAANEGLSIFVILVWLGINAFLFVQFYLVFLTDKWFYTRAILGDALSWARAPAACLN
FNCMLILLPVCRNLLSMLRGTIQCCSRTAARQLDRNITFHKLVAYMIAVHTAVHILAHLF
NFERFMDGQLNRDAHLITFVLSDIGNRGNASYLNPIRTNETNPTIIMFTTIAGVTGVVIT
LALILIITSSMEVIRRSYFEVFWFTHHLFVIFFIGLVFHGFGRIVRGQTAASLRAHNPLE
CVDKFETWGKNGSNCPEPEFAGNPPMTWKWVVGPMILYVCERLVRLYRYQQKVVITKVVM
HPSKTLELRMKRKGFRMEAGQYVFIQCPSISALEWHPFTLTSAPEEDHFSAHIRIVGDWT
EKLYLACGGDKSESQDAWMLPRLAIDGPFGTASEDVFRYEVVVLVGAGIGVTPFASVLKS
VWYQTSQGQEDVFTKKIYFYWLCPETQAFEWFADLLQSLEGQMTEKGLADFLNYNIYLTR
WKENEAAHFRVHHEAENDPITGLKQKTLYGKPNWDNEFTNIGAKHPGTKVGVFLCGPTVL
GKALARQCLSHSEGGVEFIFNKENF
Download sequence
Identical sequences ENSGMOP00000004933 ENSGMOP00000004933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]