SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004961 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004961
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily EF-hand 4.88e-56
Family Calmodulin-like 0.0000000831
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004961   Gene: ENSGMOG00000004685   Transcript: ENSGMOT00000005105
Sequence length 193
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1782:64342:70970:-1 gene:ENSGMOG00000004685 transcript:ENSGMOT00000005105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKQNSKLRPEMLQDLRENTEFSDHELQEWYKGFLKDCPSGNLNVEEFKKIYANFFPYGD
ASKFAEHVFRTFDTNADGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISRDE
MLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFRQMDLNNDGKLSLEEFIKGAKSDPSIV
RLLQCDPSSASQF
Download sequence
Identical sequences ENSGMOP00000004961 ENSGMOP00000004961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]