SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004990 from Gadus morhua 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004990
Domain Number 1 Region: 6-176
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.37e-48
Family DBL homology domain (DH-domain) 0.00054
Further Details:      
 
Domain Number 2 Region: 160-294
Classification Level Classification E-value
Superfamily PH domain-like 1.59e-30
Family Pleckstrin-homology domain (PH domain) 0.0026
Further Details:      
 
Domain Number 3 Region: 278-380
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000863
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0098
Further Details:      
 
Domain Number 4 Region: 406-441
Classification Level Classification E-value
Superfamily PH domain-like 0.0000466
Family Pleckstrin-homology domain (PH domain) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004990   Gene: ENSGMOG00000004698   Transcript: ENSGMOT00000005136
Sequence length 442
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4133:21341:28074:1 gene:ENSGMOG00000004698 transcript:ENSGMOT00000005136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEAGKGTFPVEVVKNIFSNISSVHTFHSQFLLPDLERRMGEWESTPRIGDILLKLTPFL
KMYAEYVKNFDQAMELLKQWSDRSPQFKSIIQEIQGQCQEVCGSLTLQHHMLEPVQRVPR
YEMLLKDYLKKLPPDHLDRRDAEKSLEIIATAATHSNSAIRKSDNLKKLLEIYEMLGEEE
DIVNASNEFIKEGHILKLAARNTSAMERYLFLLNNMLLYCVPKFSLGGPKYTLRTRIGMD
GMKVLETSNEDYPHTFQVSGKERMLELQASSEQDKAGWIKALQETIAVFQQKNESFKTAS
KEVEEVSTAELGKRAPRWIRDNEVTMCMKCXXXXXXXXXXXXXXXXXXXVVCWKCSDNKV
ALQYDNNKVNKVCRDCFSILTGEEPAEGKKKGILEIGAGQFTGSSIMCGFLQYSEKTKPW
QKVWGVLPEKECLVLYLYGAPQ
Download sequence
Identical sequences ENSGMOP00000004990 ENSGMOP00000004990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]